KEGG   Citrobacter farmeri: CI104_21125Help
Entry
CI104_21125       CDS       T05012                                 

Definition
(GenBank) ribose-5-phosphate isomerase RpiA
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
cfar  Citrobacter farmeri
Pathway
cfar00030  Pentose phosphate pathway
cfar01100  Metabolic pathways
cfar01110  Biosynthesis of secondary metabolites
cfar01120  Microbial metabolism in diverse environments
cfar01130  Biosynthesis of antibiotics
cfar01200  Carbon metabolism
cfar01230  Biosynthesis of amino acids
Module
cfar_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cfar_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:cfar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CI104_21125
Enzymes [BR:cfar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     CI104_21125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: AST81412
UniProt: A0A223JW92
LinkDB All DBs
Position
complement(4256690..4257349)
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KSLGIPVFDLNEVDSLGVYVDGADEINGHMQMIKGGGAALTREKIIASVAKKFICIADAS
KEVDILGNFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVHGMEILDPV
AMENAINAIPGVVTVGLFANRGADVALIGTADGVKTIVK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgaactgaaaaaagcagtaggatgggcggcacttcagtatgtacagccc
ggcaccattgttggggtaggtaccggttcaacagccgcgcactttattgacgcgctgggc
accatgaaaggtcagattgaaggtgctgtttccagttcggatgcctcaaccgaaaaactc
aaaagccttggcatccctgtatttgatctcaacgaagtggacagcctcggcgtctacgtc
gacggggctgatgagattaacggtcacatgcagatgattaaaggtggtggcgcggcgctg
actcgtgaaaagatcattgcctccgtggcgaagaaatttatctgtattgccgatgcttcc
aaggaagtggatatcctgggtaacttcccgttgccggttgaggttatcccaatggcgcgt
agtgcggtggctcgccagttggttaaactgggtggtcgtccggaatatcgtcagggggtg
gtcactgacaacggcaacgtgatcctcgatgtgcacggaatggagatcctcgatccagtg
gcgatggaaaatgccattaatgccattcctggcgtggttaccgtcggcctgtttgccaac
cgtggcgcggatgtcgcgttaatcgggactgctgacggtgtcaaaaccatcgtgaaatga

DBGET integrated database retrieval system