KEGG   Corynebacterium flavescens: CFLV_01230Help
Entry
CFLV_01230        CDS       T05018                                 

Definition
(GenBank) glutamine amidotransferase
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
cfc  Corynebacterium flavescens
Pathway
cfc00550  Peptidoglycan biosynthesis
cfc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CFLV_01230
Enzymes [BR:cfc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     CFLV_01230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 GATase DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: APT85956
UniProt: A0A1L7CJC0
LinkDB All DBs
Position
complement(262268..263026)
Genome map
AA seq 252 aa AA seqDB search
MDKLTIGLVLPDVLGTYGDDGNALVLRQRARMRGLKAEILPIKLNEPVPDSLDIYTLGGG
EDTAQILAAEHLIADGGLSRAAAAGHPVLAICAGLQVLGESFRASGRIVDGVGLIDATTA
GMQERAIGEVASTPTGTGITAELTEPLTGFENHMGATILGPAAQPLGEITRGVGNADTNA
TADLRDGAMQRTAEGAVQGNVIATYMHGPALARNPQLADLLLAKAMGITLAELEPLDIPA
VTQLRAERLRRS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggataaactcaccatcggcctcgtcctccccgacgtgctgggcacctacggcgacgac
ggaaacgccctggtcctgcgccagcgcgcgcgcatgcgtggactgaaggcggagattctg
cccatcaagctcaacgagcccgtccccgattccctcgacatctacaccctgggtggtggc
gaggacaccgcgcagattttggctgcagagcacctcatcgctgacggcggattgagccgg
gcggctgccgccgggcaccccgtgctggcgatctgcgccggcctgcaggtcctgggcgag
tccttccgcgcttcgggccgcatcgtggacggcgtcgggctaatcgacgccaccactgcc
ggcatgcaggagcgcgccatcggcgaggtggcctccacccccaccggcactggcatcacc
gccgagctcaccgagccgctgaccggctttgagaaccacatgggcgcgaccatcctgggc
cccgccgcgcagccgctcggcgagatcacccgcggcgtgggcaatgccgataccaatgcc
accgccgacctgcgtgacggcgccatgcagcgcaccgccgagggcgcagtccagggcaac
gtcatcgccacctacatgcacggccccgctcttgcgcgcaacccccagctggctgatctc
ctgctggccaaggccatgggcatcacgctggccgagctcgaaccgctcgacattcccgcc
gtcacgcagctgcgcgccgaacgcctgcgtaggtcttag

DBGET integrated database retrieval system