KEGG   Corynebacterium flavescens: CFLV_02090Help
Entry
CFLV_02090        CDS       T05018                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cfc  Corynebacterium flavescens
Brite
KEGG Orthology (KO) [BR:cfc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cfc03012]
    CFLV_02090
   03029 Mitochondrial biogenesis [BR:cfc03029]
    CFLV_02090
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfc04147]
    CFLV_02090
Translation factors [BR:cfc03012]
 Eukaryotic Type
  Elongation factors
   CFLV_02090
 Prokaryotic Type
   CFLV_02090
Mitochondrial biogenesis [BR:cfc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CFLV_02090
Exosome [BR:cfc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CFLV_02090
  Exosomal proteins of breast cancer cells
   CFLV_02090
  Exosomal proteins of colorectal cancer cells
   CFLV_02090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: APT86099
UniProt: A0A1L7CJV9
LinkDB All DBs
Position
454059..455249
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADKYPDENTAFAFDMIDKAPEEKE
RGITINISHVEYSTPKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEIRELLAEQDYDEDAPIIHISALKAL
EGDEKWVQAIVDLMQACDDSIPDPERETDKPFLMPIEDIFTITGRGTVVTGRVERGVLKV
NEDVEIIGIKEKSISTTVTGIEMFRKMMDYTEAGDNCGLLLRGTKREEVERGQVVIKPGA
YTPHTKFEGSVYVLKKEEGGRHTPFMDNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNVD
MTVELIQPVAMDEGLRFAIREGSRTVGAGRVTKVLA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggagaagttcgagcgtacgaagccgcatgtgaacatcggcaccatcggacac
gtcgaccacggcaagaccaccaccaccgcagcaatcaccaaggttcttgcggacaagtac
cctgatgagaacaccgctttcgctttcgacatgatcgataaggctcctgaggagaaggag
cgcggcatcaccatcaacatctcccacgttgagtactccaccccgaagcgccactacgca
cacgttgacgccccgggccacgccgactacatcaagaacatgatcaccggtgctgcgcag
atggatggcgccatcctggttgttgctgcaaccgatggtcctatgccgcagacccgcgag
cacgttcttctggctcgccaggttggcgttccttacatcctcgttgctcttaacaagtgc
gacatggttgatgatgaggaaatcatcgagctcgttgagatggaaatccgcgaactgctc
gctgagcaggactacgacgaggatgcccccatcatccacatctccgctctcaaggctctt
gagggtgacgagaagtgggtacaggccatcgtcgacctcatgcaggcctgcgatgactcc
attccggatccggagcgcgagaccgacaagcccttcctcatgcctatcgaggacatcttc
accatcaccggccgcggtaccgttgttaccggccgtgttgagcgtggcgttttgaaggtc
aacgaggatgttgagatcatcggcatcaaggagaagtccatctccaccaccgttaccggt
atcgaaatgttccgcaagatgatggactacaccgaggctggcgacaactgtggtctgctt
ctgcgtggtaccaagcgtgaagaggtcgagcgcggccaggttgttatcaagccgggcgcc
tacaccccccacaccaagttcgagggttccgtctacgtcctcaagaaggaagagggcggc
cgccacaccccgttcatggacaactaccgtccgcagttctacttccgtaccactgacgtg
accggcgttgttcacctgcctgagggcaccgagatggtcatgcctggcgacaacgttgat
atgaccgttgagctcatccagcccgtcgctatggatgagggcctgcgcttcgctatccgc
gaaggttcccgcaccgtcggcgccggccgcgtaaccaaggttcttgcttaa

DBGET integrated database retrieval system