KEGG   Corynebacterium flavescens: CFLV_02735Help
Entry
CFLV_02735        CDS       T05018                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cfc  Corynebacterium flavescens
Pathway
cfc00620  Pyruvate metabolism
cfc00680  Methane metabolism
cfc01100  Metabolic pathways
cfc01120  Microbial metabolism in diverse environments
cfc01200  Carbon metabolism
Module
cfc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cfc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFLV_02735
  09102 Energy metabolism
   00680 Methane metabolism
    CFLV_02735
Enzymes [BR:cfc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CFLV_02735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: APT86213
UniProt: A0A1L7CKB6
LinkDB All DBs
Position
573113..575770
Genome map
AA seq 885 aa AA seqDB search
MTTPPNDQVRADIRFLGRVLGQVIAQQEGQEVFELVESTRVLAFEVARGNARAEDLVAIF
RDLDISKVNLVARAFSYFALLSNLAEDLEDEAVPAAVSLRTTFAKLRESSITPAQAAEVI
RDAQVTPVLTAHPTETRRRTVFDTQTRIKQLLRHSHTAADNTDIERELYLRMTLLWQTAL
IRVTRPTLEDEVDVGLRYYKLSLLEEIPAINRDIRRGMHEVFGLSLPEAPVVRPGSWIGG
DHDGNPFVTAETLTYATRRAALTVLRYYQRELAALERELSLSDRYSSCSGELLTLAEASE
NDAKSRVDEPYRRAVFGIRHRVEAKLAVLEDKAPESEPYGEPAQLRYDLDIIDRSLRQHN
DAVIADDRLARLRSALSTFGFHLYTLDLRQNSESFEKVLSELFRRAGRCEDYAALAEEDK
IDILVAELATPRPLLFPGVEGLSADTEKELGIFRAAARAVADFGLQSISHCIISMTGAVS
DVLEPMILLKEVGLDHLGMVPLFETIDDLKAGADILEQLWQVPAYRAHLRSCGDVQEVML
GYSDSNKDGGYLQANWALYDAELALVDVCQRHGVELRLAHGRGGAVGRGGGPTYDAILAQ
PQGAVNGSVRITEQGEVISAKYGSPETARRHLEAFVSGVLEASLLDTEPIADPERAYATM
RELSTLSGQKYRELLEDPGFIEYFTESTPLHEIGDLNLGSRPAARKQTSAISDLRAIPWV
LSWSQSRTNLPGWFGVGSAVREWVDGGSEPERWEELRELYLSWPFFRSVFSNMAQVMAKA
EMSLARLYADLVEDQEVARRIYGIIAEEFERTREVYQEVTGNADLVSENQRQARSLRRRY
PYLLPLNAVQLELLRRYRAGDDSFLVSKTIQVTMNGLATALRSSG
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacaccgcctaatgaccaagtccgcgcagacattcgctttctcggccgagtactt
ggccaggtcatcgcgcaacaggagggccaggaggtcttcgagctggtggaatcgacccgc
gtgctcgccttcgaggtggcgcgcggcaacgcccgcgccgaggacctcgtcgccatcttc
cgcgacctagacatctccaaggtcaatctagttgcccgcgccttcagctacttcgccctg
ctgagcaacctggccgaggacctcgaggatgaagcggtccccgcagccgtctccctgcgc
acgacctttgccaagctgcgcgaatcctcgatcaccccggcgcaggcggcggaggtcatc
cgtgacgctcaggttaccccggtgctgacggcccatcccacggagacgcggcgtcggacg
gtatttgatacccagacccggatcaaacagctgctgcgccacagtcacacggccgcagat
aatacggacatcgaacgcgagctctacctgcgcatgacgctgttgtggcagacggcgctc
attcgcgttactcggcccacgctcgaggacgaggtcgacgtcggattgcgctattacaag
ctctcgctcctcgaagagatcccggcgatcaaccgcgatattcggcggggaatgcacgaa
gtctttgggctttcgcttcccgaagcccccgtggtccgccccggctcctggatcggcgga
gaccacgacggcaaccccttcgtcacggcggaaaccctaacttatgccacgcgccgcgcg
gcgctgaccgtgctgcgctattaccagcgtgagctggcggccctcgagcgtgaactgagc
ttgtcggatcgctattcttcctgctcgggcgagcttctaactcttgcggaggcaagtgaa
aatgacgcgaagtcccgcgtggatgagccctatcgccgtgcggttttcggaatccggcac
cgtgtcgaggccaagctcgcagtcttggaggataaagcgcccgaatccgagccctacggc
gaacctgctcagctgcgctatgacctcgacatcatcgaccgctccttgcgccagcacaac
gacgctgtgatcgccgacgaccgactcgcgcgcctgcgctctgcgctgtctaccttcggc
ttccacctctacacccttgacctgcggcagaactctgagtcttttgagaaggtgctgagc
gagctcttccgccgcgccggacgctgcgaggactatgccgcgctggcggaggaggacaag
attgacatcctcgtcgcggagctggccacgccgcggccactgctctttcccggggtggag
ggcctgagcgcggatacggagaaggagctaggcatcttccgagccgccgcgcgtgccgtc
gctgatttcggtctgcagtccatctcccattgcataatttctatgactggcgcggttagt
gatgtcctcgagccgatgatcctgctcaaggaagtcgggctggaccacctcggcatggtt
cctttgtttgagaccatcgatgatcttaaggcaggcgctgacattttggagcagctgtgg
caagtcccggcctaccgtgcgcatttgcgttcttgtggcgacgtgcaggaggtgatgctg
gggtactccgattccaacaaagatggcggctatctgcaggccaactgggcgctttacgac
gccgaacttgccctcgtcgacgtatgccagcgccacggcgtcgaactgcgcctcgcccac
gggcgcggcggcgcagtaggaaggggcggcggaccgacctatgacgccatcctggctcag
ccccaaggcgcggttaatggctcggtgcgcatcactgagcaaggcgaggtgatttccgcg
aagtacggctccccggagactgcgcgccgccacctcgaagcctttgtctccggggtgctt
gaagcctcgttgctcgacaccgaacccatcgctgaccctgagcgtgcctatgccacgatg
cgagaactatccactctttcgggacagaagtatcgcgagctgcttgaggatcccggcttc
atcgagtacttcacggaatcgacgccgctgcatgaaatcggagacctcaacttgggctcg
cgcccagccgcccgcaagcagacgagcgcaatatctgacctacgcgccattccgtgggtg
ctgtcgtggtctcaatcccggacaaacctgccgggctggttcggcgtcggaagtgcggtg
cgcgaatgggtggacggcggaagcgagccggagcgctgggaggagctgcgcgagctttat
ctttcctggcccttcttccgcagcgtcttttccaacatggcgcaggtcatggcgaaggcg
gagatgtctttggctcgcctttacgcggacttggtcgaggatcaggaggtagccaggcgc
atttatggcatcatcgcggaggagtttgagcgcacgcgtgaggtttatcaggaggtcacg
ggcaatgcggacctcgtgtctgaaaaccagcgccaagctcgctctttgcgcaggcgctat
ccctacttgcttccccttaacgcggtgcagctggagcttttgcgccgctatcgcgcaggg
gatgactccttcctcgtttccaaaaccatccaggttacgatgaatggccttgctaccgca
ctgcggagttctggctag

DBGET integrated database retrieval system