KEGG   Corynebacterium flavescens: CFLV_05630Help
Entry
CFLV_05630        CDS       T05018                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cfc  Corynebacterium flavescens
Pathway
cfc00473  D-Alanine metabolism
cfc00550  Peptidoglycan biosynthesis
cfc01100  Metabolic pathways
cfc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cfc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFLV_05630
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CFLV_05630
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CFLV_05630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cfc01011]
    CFLV_05630
Enzymes [BR:cfc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CFLV_05630
Peptidoglycan biosynthesis and degradation proteins [BR:cfc01011]
 Precursor biosynthesis
  Amino acid ligase
   CFLV_05630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 CPSase_L_D2 RimK ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: APT86716
UniProt: A0A1L7CLH5
LinkDB All DBs
Position
1203598..1204665
Genome map
AA seq 355 aa AA seqDB search
MNSKIRVAVIYGGRSTEHSVSCVSAGAIMANLDPAKYEIIPIGITKDGAWTQGVTSGLEI
HNRMLPEVAMGDELTLSLNPATKGTFYNLSKGGVHAQVDVILPVLHGPFGEDGTIQGLFE
LSGVPYAGAGVLASAASMDKEYTKKLLAAEGIPVAAQVVLTGARELQEEEKHSLGLPVFV
KPARGGSSIGVSRVSDWSELAAALDVAFATDSKVLIEPEIVGQEVEIGVLQYADGSLLAS
EPALLAGIADSEDGFYSFDTKYLDDVVTAQIPAPLEPAVTLEIKEMALEAFRALDCAGLS
RVDFFVTESGAIVNEVNTFPGFTPISMYPQVLAHSGVEYTRLLDCLIEQALGSAA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaaagatccgcgtggccgtcatctacggtggccgaagcaccgagcattccgta
tcctgcgtgtcggcgggggccatcatggccaaccttgaccccgccaaatacgagatcatc
ccgatcgggatcaccaaggacggcgcttggacgcagggcgtcaccagtggacttgagatc
cacaaccgcatgctgcctgaggtagcaatgggcgatgagctcaccctctccctcaaccct
gcgactaaaggcacgttctataacctcagcaaaggtggcgtgcacgcgcaagtagacgtt
atcctgccggtgttgcacgggccattcggggaggatggcaccatccagggtctttttgag
ctctccggcgtgccctacgcgggcgcgggcgttctcgcctccgccgcctccatggacaag
gagtacaccaagaagctgctcgcagctgaaggcattccggtggctgcccaggtcgtgctc
actggtgcgcgcgaactgcaagaggaagaaaagcacagcctagggctgccggtttttgtt
aagccggcccgtggtggctcctccattggtgtctcgcgggtgagtgactggagcgaactt
gccgctgcccttgacgtggcctttgccaccgatagcaaggtcctcatcgagccagagatt
gtgggacaagaggtagagatcggggtgctccagtacgctgatggttccttgctggcctcg
gagccggccctgctggctggcatcgcagactcggaagacggtttctacagcttcgacacc
aagtacttggatgatgtagtcacggcgcagatcccagctccgctggagcctgcggtgaca
ctcgagatcaaagagatggcgctagaggcattccgcgcgctcgattgcgcgggtctttcg
cgcgtcgacttctttgtcaccgagtccggcgccatagtcaacgaagtcaacaccttccca
ggattcaccccgatttcgatgtacccacaggtgctggcgcattccggagtggagtacacc
cgcctgctggattgcctcatcgagcaggcgctgggctccgcagcttaa

DBGET integrated database retrieval system