KEGG   Corynebacterium flavescens: CFLV_06820Help
Entry
CFLV_06820        CDS       T05018                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
cfc  Corynebacterium flavescens
Pathway
cfc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cfc01100  Metabolic pathways
cfc01110  Biosynthesis of secondary metabolites
cfc01130  Biosynthesis of antibiotics
cfc01230  Biosynthesis of amino acids
Module
cfc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cfc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFLV_06820
Enzymes [BR:cfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CFLV_06820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 AAA_17 AAA_5 AAA_22 Cytidylate_kin Ploopntkinase3 AAA_28 AAA_16 AAA Mg_chelatase AAA_24 AAA_25 ABC_tran ADK Cytidylate_kin2 AAA_30 MeaB Zeta_toxin RNA_helicase RuvB_N NTPase_1 IstB_IS21 MMR_HSR1 AAA_29 KTI12 DUF2075 6PF2K
Motif
Other DBs
NCBI-ProteinID: APT86936
UniProt: A0A1L7CM48
LinkDB All DBs
Position
complement(1463349..1463885)
Genome map
AA seq 178 aa AA seqDB search
MTTPVAVTGNPRPRIVLVGPPGAGKSTIGLRLAHALNCELVDSDDLVAAEYGKSCGEVFA
ELGEPKFREVEARIVAQALESKGVVSLGGGAVLSEATRELLDRHTVIYLEITAEEGASRT
AGDDSRPVLQSADPIGHYRTLLEARHPLYTEVADFKIRTGSRSPQQVVGEVLSFMETL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacccgttgccgtcaccggaaacccccgaccgcgcatcgtcttggtcggtccc
cctggggcgggcaagtcgaccatcggcctgcgtcttgcgcacgcgctgaactgcgagttg
gttgattcggatgatctcgtcgccgcagaatatggcaagagctgtggcgaggttttcgcc
gagctaggggagccgaagttccgtgaagttgaagcccgcattgtagcccaggcacttgaa
agcaaaggcgtagtcagcctcggtggaggagcggtgctcagcgaagcaacgcgtgagctc
ttagatcgtcacacggtgatctatcttgagatcactgctgaggagggcgccagccgcacg
gcgggggatgattcacggccggtgcttcagtctgcagatcccataggccattaccgcact
ctcctcgaagcgcggcacccgctctatacggaagtggcggactttaagatccgcactggc
tcccgctccccgcagcaggtggtgggagaggtcttgagttttatggagaccctgtag

DBGET integrated database retrieval system