KEGG   Citrobacter freundii: CFNIH1_00310Help
Entry
CFNIH1_00310      CDS       T03077                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
cfd  Citrobacter freundii
Pathway
cfd00250  Alanine, aspartate and glutamate metabolism
cfd00280  Valine, leucine and isoleucine degradation
cfd00310  Lysine degradation
cfd00410  beta-Alanine metabolism
cfd00640  Propanoate metabolism
cfd00650  Butanoate metabolism
cfd01100  Metabolic pathways
cfd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CFNIH1_00310
   00650 Butanoate metabolism
    CFNIH1_00310
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFNIH1_00310
   00280 Valine, leucine and isoleucine degradation
    CFNIH1_00310
   00310 Lysine degradation
    CFNIH1_00310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFNIH1_00310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfd01007]
    CFNIH1_00310
Enzymes [BR:cfd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CFNIH1_00310
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CFNIH1_00310
    2.6.1.48  5-aminovalerate transaminase
     CFNIH1_00310
Amino acid related enzymes [BR:cfd01007]
 Aminotransferase (transaminase)
  Class III
   CFNIH1_00310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHY10020
LinkDB All DBs
Position
68638..69921
Genome map
AA seq 427 aa AA seqDB search
MSTNKELMQRRSNAVPRGVGQIHPIFAERAENCRVWDVEGREFLDFAGGIAVLNTGHLHP
QIVSAVEAQLKKLSHTCFQVLAYEPYLELCEIMNKKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRTGTIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALFPCPLHGISE
DDAIASIHRIFKNDAAPEDVAAIVIEPVQGEGGFYAVTPAFMQRLRAICDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRADVMDAIPPGGLGGTYAG
NPIACAAALAVLNIFEQENLLQKANELGQTLREGLLAIAETHREIGDVRGLGAMIAIELF
EDGDHTKPDAKLTAEVVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLDIIAQC
FAEAKQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaacaaagaactcatgcaacgtcgcagcaacgccgttccccgtggcgtagga
cagatccaccctatttttgccgagcgggcagaaaactgccgggtctgggacgttgaaggc
cgcgaattcctcgattttgctggcggtattgcggtgctgaataccggtcacctgcacccg
cagattgtctctgcggtagaagcgcagttgaaaaaactgtcgcatacctgcttccaggtg
ctggcctatgagccctacctggagctgtgcgaaatcatgaacaagaaagtgccgggcgat
ttcgccaagaaaaccctgctggtgaccaccggttctgaagccgtggaaaacgcggtgaaa
attgcccgcgccgccaccaaacgtacaggtacgatcgccttcagcggcgcttatcatggc
cgtacccactacaccctgtcgctgaccgggaaagtcaacccgtactccgccggaatgggg
ctgatgccgggccatgtttatcgcgcactttttccttgcccgctgcatggcatcagtgaa
gatgatgctatcgccagtattcaccgcatcttcaaaaatgatgccgcgccggaagacgtt
gccgccatcgtcattgaacccgtccagggcgaaggcggtttttacgcggtcaccccggca
tttatgcagcgtctgcgcgccatttgtgacgaacacgggatcatgctgattgccgatgaa
gtgcagagcggcgcgggccgcaccggtacgctgttcgccatggagcagatgggcgttgcg
cccgatcttaccaccttcgccaaatctatcgctggcggcttcccgctggcaggggtaacc
ggtcgcgccgacgtcatggacgctatcccgccgggtggcctgggcggtacctatgccggt
aacccgattgcctgtgccgccgcgctggcggtgctgaacattttcgagcaggaaaatctg
ctgcaaaaggccaacgaactggggcaaaccctgcgcgaaggcctgctggctatcgccgaa
acgcatcgcgaaattggcgacgtgcgtgggctgggggcgatgatcgccatcgaactgttc
gaagacggcgaccatacgaaaccagacgccaagctgaccgcagaagtggtggcgcgcgcg
cgtgataaagggctgatcctgctctcctgcgggccttactacaacgtgctgcgcatcctt
gtcccgctgaccattgaagatgcgcaaatccgccaggggctggacatcatcgcccagtgt
tttgctgaggcgaagcagggctaa

DBGET integrated database retrieval system