KEGG   Citrobacter freundii: CFNIH1_11965Help
Entry
CFNIH1_11965      CDS       T03077                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cfd  Citrobacter freundii
Pathway
cfd00473  D-Alanine metabolism
cfd00550  Peptidoglycan biosynthesis
cfd01100  Metabolic pathways
cfd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cfd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFNIH1_11965
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CFNIH1_11965
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CFNIH1_11965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cfd01011]
    CFNIH1_11965
Enzymes [BR:cfd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CFNIH1_11965
Peptidoglycan biosynthesis and degradation proteins [BR:cfd01011]
 Precursor biosynthesis
  Amino acid ligase
   CFNIH1_11965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AHY12200
UniProt: A0A023V8J4
LinkDB All DBs
Position
complement(2489336..2490430)
Genome map
AA seq 364 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKQGQWHVSDASNYLLN
SDDPAHIALRPSATSLAQVPGKQEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIAPFITLTRANRNNISFAEVQSRLGL
PLFVKPANQGSSVGVSKVTSEAQYNQAVALAFEFDHKVVVEQGIKGREIECAVLGNDHPQ
ASTCGEIVLNSDFYAYDTKYIDDNGAKVVVPAAIAPEINDKIRQIAIQAYQTLGCAGMAR
VDVFLTADNDVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADSAL
KTSM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttgcgggtaggaatcgtatttggtggtaaatcagcggaacatgaagtgtca
ttgcaatcggcaaaaaatattgtcgatgccatcgacaagactcgctttgacgttgtgctg
ttaggtattgataaacaagggcaatggcacgttagcgatgccagtaactatctgctcaat
tcagacgatccggcgcacattgcgctgcgtccttccgcgaccagtctggctcaggttccg
ggtaaacaagagcaccagttgatcgatgcgcaaaacggtcagccgctgccgacggtcgat
gttattttcccgatcgtccacggtacgctgggtgaagatggctctttgcagggtatgctg
cgcgtagcgaatctgccgttcgtcggttctgatgtcctgggttccgcagcctgtatggat
aaagacgtaaccaaacgtctgctgcgcgatgccggattaaatatcgcgccatttattaca
ctcactcgcgcgaaccgcaacaatattagctttgctgaggtgcaatcccgcctgggtctg
ccgttgttcgtgaaacccgccaaccagggatcgtccgttggcgttagcaaagtgaccagt
gaagcgcaatacaaccaggctgtcgcgctggcatttgagttcgatcataaagtcgtggta
gagcaagggatcaaaggccgtgagatcgaatgcgcggtactgggcaacgatcatccgcag
gccagcacctgtggtgagatcgtgctgaacagtgatttttacgcatacgacaccaaatac
attgacgataatggcgccaaagtagttgttccggcagcgatcgcgccagagattaacgac
aagatccgccagatcgccattcaggcgtaccagacactgggatgtgccggcatggcgcgt
gtagatgtattcttaaccgcagacaacgacgttgtgatcaatgagatcaacaccctgccg
ggcttcaccaacatcagtatgtatccaaaactgtggcaggcgagcggcttaggctatacc
gatttgatcacgcgtctgatcgaactggcgctggagcgccacgctgcggatagcgcgctg
aaaaccagtatgtaa

DBGET integrated database retrieval system