KEGG   Citrobacter freundii: CFNIH1_11980Help
Entry
CFNIH1_11980      CDS       T03077                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cfd  Citrobacter freundii
Pathway
cfd00730  Thiamine metabolism
cfd00790  Folate biosynthesis
cfd01100  Metabolic pathways
cfd02020  Two-component system
Module
cfd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cfd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CFNIH1_11980
   00790 Folate biosynthesis
    CFNIH1_11980
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFNIH1_11980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfd04147]
    CFNIH1_11980
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfd00537]
    CFNIH1_11980
Enzymes [BR:cfd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CFNIH1_11980
Exosome [BR:cfd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFNIH1_11980
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfd00537]
 Enzymes
  CFNIH1_11980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: AHY12203
UniProt: A0A023V983
LinkDB All DBs
Position
2492523..2493938
Genome map
AA seq 471 aa AA seqDB search
MKQSALAIALLPLLFTPIINAETSTVAVMDNRAAQGDITTPGGARRLSADQTAALRESLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHEKDHATILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPDVTREKCPTNALEKGGKGSITEQLLNARADVTLGGGAKTFAETAAAG
EWQGKTLREQALARGYQMVSDAATLAAITEANQDKPLLGLFSDGNMPVRWEGPKASYHGN
LDKPAVTCTPNPKRDDTVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALAFAKQDGNTLVVVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VISYGNSEEESQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcgcactcgctattgccctgttacctttgctgtttaccccgattattaat
gcagaaacatctaccgtagcggttatggataatcgtgccgctcagggtgatatcaccacg
ccaggcggcgcccgccgattgtcagccgatcaaacggcggctttacgcgaatctctgaac
gataaacctgccaaaaatatcattttacttattggcgatgggatgggcgattctgaaata
acggcagcgcgaaattatgccgaaggcgcgggcggtttttttaaaggtattgatgcttta
ccgttgaccggacaatacacgcactatgcgttagataagaaaacgggcaagccggattat
gtgacggactcagcggcctcagcgacggcgtggaccaccggggttaaaacttacaatggc
gcgctgggcgttgatatacatgaaaaagatcacgcaacaattttggaaatggcaaaagcg
gcaggtctggcgacgggcaacgtttctaccgctgaattgcaggatgcaaccccagcggca
ctggttgctcatgtgacttcacgtaagtgctatggccctgacgtgacccgtgaaaaatgc
ccaaccaatgccctggaaaaaggcggcaaagggtcaattacagaacaattgctgaatgcc
cgggctgacgtcacgttgggcggtggggcaaaaacgtttgccgaaaccgctgcggcaggg
gagtggcagggtaaaacgttgcgtgaacaagccctggcgcgcggttatcagatggtaagt
gatgccgcgacgctggctgcgattaccgaagctaaccaggataagccgttgctgggcttg
ttctccgacggcaacatgccggtacgctgggaaggtccgaaagcgtcctatcatgggaat
ctggataaaccagcggtgacctgtacgccaaatccaaagcgtgatgacaccgtaccgacg
ctggcgcagatgacggataaagcgattgaactgttaagcaaaaatgagaaaggtttcttc
ctgcaagttgaaggggcatccatcgataaacaggatcacgccgccaacccgtgcggacag
attggtgaaacggttgatctggacgaagcggtacagcgcgcgcttgcctttgcgaagcaa
gacggcaacaccctggtggtggtaaccgctgaccacgcgcatgccagccagattgtcgcg
cctgatactaaagcgcctggtctgactcaggcactgaacaccaaagatggcgcggtgatg
gtcatcagctacggcaattctgaagaggaatctcaggagcacaccggtagccagttgcgc
atcgccgcttatggcccacatgcggcgaatgtggtcggtctgaccgatcaaactgatctg
ttttacaccatgaaagcggcgttagggctgaagtaa

DBGET integrated database retrieval system