KEGG   Citrobacter freundii: CFNIH1_22795Help
Entry
CFNIH1_22795      CDS       T03077                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cfd  Citrobacter freundii
Pathway
cfd00564  Glycerophospholipid metabolism
cfd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cfd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CFNIH1_22795 (glpA)
Enzymes [BR:cfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CFNIH1_22795 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Pyr_redox_2 Thi4 3HCDH_N HI0933_like NAD_binding_8 FtsA Pyr_redox_3 Lycopene_cycl SO_alpha_A3 Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: AHY14255
LinkDB All DBs
Position
4670381..4672009
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQTSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDELSFQATFIRACEEAGIRAEA
IDPQQARIIEPSVNPQLIGAVKVPDGTVDPFRLTAANMLDAREHGAVILTAHEVTGLIRE
GTTVCGVNVRNHLTGEMQSLHAPVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSQHIDYDDIDSNRVTAEEVDILLREGEKLAP
IMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNSQPCTTADTALPGSQESTEHTLKRVISLPAPLRGSAVYRHGDRTP
AWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTAAQSITQLSDFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEHQD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaaacaagtgacgtgattatcattggtggaggagcaacaggt
gcagggatcgcacgcgactgtgcgctgcgcgggttgcgcgtcatcttagtggaacgccac
gatatcgccacgggcgcgaccggacgtaaccatggcctgctgcacagcggtgcgcgctac
gccgtcaccgacgctgaatctgcccgtgagtgcatcagcgaaaaccagattctgaaacgt
atcgcccgtcattgcgttgagccgacggacggtctgtttattaccctgccggaggatgag
ctctccttccaggctaccttcattcgcgcctgtgaagaggccggtattcgcgcagaagcg
attgaccctcagcaggcgcgcattatcgaaccctccgtcaacccacagctgattggcgcg
gtcaaagtgcccgacggtacggtcgatcccttccgcttaaccgccgccaacatgctggat
gcgcgtgagcatggcgcggttatcttaacggcccatgaagtgacggggctgattcgcgaa
gggacaacggtttgcggcgttaacgtgcgcaatcatctgacgggtgagatgcagtccctg
catgcgccggtggtggtgaatgccgccgggatctggggccagcgcattgccgaatatgcc
gatctgagtatccggatgttcccggccaaaggatcgctgctgattatggatcatcgcata
aaccagcatgtcattaatcgctgccgtaaaccttctgacgccgatattctggtgcctggc
gataccatttcgctcattggtaccacctcgcagcacattgattacgacgatatcgacagc
aaccgcgtcaccgcagaagaggtcgatattctgctgcgcgaaggtgagaaactggcgccg
attatggcgaaaacgcgcattttacgcgcctactccggtgtgcgaccgctggtcgccagc
gacgacgatccaagcggtcgtaacgtcagccgcggtattgtgctgttcgatcacgctgaa
cgtgacggactggatgggtttatcaccattaccggcggcaaactgatgacctaccgtctg
atggcggaatgggccaccgatgccgtttgccgtaagctgggcaattctcaaccttgcacc
accgcagacaccgcgctgcccggctcgcaggaatccaccgagcacacgctgaaacgcgta
atttcgttgcccgcgccgttgcgcggttcggcggtctaccgtcacggcgatcgcaccccg
gcgtggcttagcgaaggtcgtcagcaccgtagcctggtctgtgaatgtgaagcggtcact
gcgggcgaagtgcaatacgccgtcgagaatttaaccgtcaacagcctgctggatttgcgt
cgccgtacccgcgttggtatggggacctgccagggcgaattgtgcgcctgccgcgccgca
ggtttgctgcaacgttttaatgtcaccaccgctgcgcaatctattacccagctttccgat
ttcctcaacgagcgctggaaaggcgtgcagcctatcgcctggggcgacgcgctgcgcgaa
agcgaattcacgcgctgggtctatcagggattgtgcggtctggaaaaggagcaccaggat
gaaatttga

DBGET integrated database retrieval system