KEGG   Citrobacter freundii: CFNIH1_23220Help
Entry
CFNIH1_23220      CDS       T03077                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cfd  Citrobacter freundii
Pathway
cfd00071  Fatty acid degradation
cfd00280  Valine, leucine and isoleucine degradation
cfd00281  Geraniol degradation
cfd00310  Lysine degradation
cfd00362  Benzoate degradation
cfd00380  Tryptophan metabolism
cfd00410  beta-Alanine metabolism
cfd00640  Propanoate metabolism
cfd00650  Butanoate metabolism
cfd00903  Limonene and pinene degradation
cfd00930  Caprolactam degradation
cfd01100  Metabolic pathways
cfd01110  Biosynthesis of secondary metabolites
cfd01120  Microbial metabolism in diverse environments
cfd01130  Biosynthesis of antibiotics
cfd01200  Carbon metabolism
cfd01212  Fatty acid metabolism
Module
cfd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CFNIH1_23220 (fadJ)
   00650 Butanoate metabolism
    CFNIH1_23220 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFNIH1_23220 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFNIH1_23220 (fadJ)
   00310 Lysine degradation
    CFNIH1_23220 (fadJ)
   00380 Tryptophan metabolism
    CFNIH1_23220 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFNIH1_23220 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CFNIH1_23220 (fadJ)
   00281 Geraniol degradation
    CFNIH1_23220 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFNIH1_23220 (fadJ)
   00930 Caprolactam degradation
    CFNIH1_23220 (fadJ)
Enzymes [BR:cfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CFNIH1_23220 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CFNIH1_23220 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CFNIH1_23220 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AHY14338
LinkDB All DBs
Position
complement(4758256..4760403)
Genome map
AA seq 715 aa AA seqDB search
MEMTSAFTLNVRLDNIAVVTIDVPGEKMNTLKAEFASQVRAILKQIRGSKALRGVVFISA
KPDNFIAGADINMIGSCRSAQEAETLARQGQQIMAEIHALPIPVIAAIHGACLGGGLEMA
LACHNRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALDMILTGKQLRAKQAL
KVGLVDEVVPLSILLEAAVELAKKESSSHRSLPVRERVLAGPLGRALLFRMASKKTAQKT
QGNYPATERILEVIETGLAQGSSSGYDAEARAFGELAMTPQSQALRHIFFANTDVKKDPG
SDAKSGPLNSVGILGGGLMGGGIAYVTACKGGLPVRIKDITAKGINHALKYSWDQLETKV
RRRHIKASERDKQLALISGSTDYRGFAHRDLVIEAVFEDLALKQKMVAEIEQNCAPHTIF
ASNTSSLPISDIAAKAARPEQVIGLHFFSPVEKMPLVEVIPHATTSEQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRLLTEGERVEAIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVASILNDDRKGRKNGRGFYLYGAKGRKSKKQVDPA
IYTLIGAQGQARLTATQIAERCVMLMLNEAARCFDEKVVRSARDGDIGAVFGIGFPPFLG
GPFRYMDSLGAGEVVAVLQRLSTQYGSRFTPCEQLLLMAERGERFWNSRETDLNS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgacatcggcttttacgctaaacgtgcgtctggataacattgctgttgtcact
attgatgtgcccggagagaaaatgaataccctgaaagcggagtttgcttctcaggttcgg
gccatcctgaaacaaattcgcggcagcaaagcgctgcgcggtgtggtgttcatttcagcg
aaacccgataacttcatcgccggagcagatatcaacatgattggtagctgccgcagcgcg
caggaagccgaaacgctggcccgccaggggcagcagattatggcggaaatccatgcgttg
ccgatcccggttatcgccgcgattcatggcgcatgtctgggcggtggcctggagatggcg
ctggcctgccataatcgtatttgtaccgatgatgctaaaaccgtactgggtttgccggaa
gtccagcttggtctgttgcccggctccggcggcacgcaacgcttgccacgccttattggc
gtcagtactgcgctggatatgatcctcacagggaaacaattgcgcgcaaaacaggcgctt
aaagtggggctggtggatgaagtcgtgccgctgtccattttgctggaagctgccgttgaa
ctggctaaaaaagagagttcctcacatcggagtctgcccgtacgtgagcgggtattagcg
gggccgctggggcgagcgctgctattccgtatggccagtaaaaagacggcgcaaaaaacg
cagggaaattatcccgcgacggaacgtatccttgaggtcattgaaaccggccttgcccag
ggaagcagtagcggttatgacgcagaagcccgcgcatttggggaattggcgatgacaccc
cagtctcaggcgctgcggcacatcttttttgccaataccgacgtgaaaaaggatccaggt
agtgatgcaaagtccggtccgctaaacagtgtcggcattctgggtggcggtctgatgggc
ggaggtatcgcctatgtgacggcctgtaaaggtggcttgccagtacgtatcaaggatatt
actgctaagggaatcaaccacgcgctgaagtacagttgggatcagcttgaaacgaaagtt
cgtcgccgtcatatcaaagccagcgagcgcgataaacagttggcgttgatttctggatct
accgattatcgcggttttgcgcatcgcgatctggttattgaagccgtgttcgaagatctg
gcgttaaaacaaaagatggtggcagaaattgaacaaaattgcgcacctcacactattttt
gcttccaacacctcatctttaccaattagtgatattgcggctaaggctgccagacctgaa
caagtgattggtttgcacttttttagcccggtggaaaaaatgccgctggttgaggtcatt
ccgcatgcaacgacctctgagcaaactattgccacaaccgtcaagttggcgaaaaaacag
ggtaaaacaccgatagtcgtcagagataaggccggattttacgttaaccgcattttagcg
ccttacatcaatgaagctatacgcctgttaaccgaaggcgagcgggttgaagccattgac
gccgcgctggttaagtttggttttccggttgggccaatccaacttttggatgaggtcgga
attgatacgggcactaaaattatacctgtgcttgaagcggcgtatggagaacgttttagc
gcgcctgcaaatgttgttgcttcaattttgaatgacgatcgcaaaggtagaaaaaatggt
cgtggtttctatctttatggggcgaaagggcgtaaaagcaaaaaacaggtcgaccctgca
atttatacgcttattggcgctcagggccaggctcgactcaccgccacgcaaattgctgag
cggtgtgtcatgttaatgctcaatgaagcagctcgctgtttcgacgagaaggtcgtccgc
agcgcccgtgatggcgatatcggcgctgtatttggtattggttttccgccattcctcggc
ggcccgttccggtatatggattccctcggcgcgggtgaagtagttgcggttctgcaacgg
ctatcaacacaatatggctcgcggtttacgccgtgtgagcagttattgctgatggcggaa
cgcggtgaaagattctggaatagtagggaaactgacctgaattcatga

DBGET integrated database retrieval system