KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_1032Help
Entry
CFF8240_1032      CDS       T00430                                 

Definition
(GenBank) penicillin-binding protein 1A (PBP-1a) (PBP1a)
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
cff00550  Peptidoglycan biosynthesis
cff01100  Metabolic pathways
cff01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cff00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CFF8240_1032
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CFF8240_1032
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cff01003]
    CFF8240_1032
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cff01011]
    CFF8240_1032
Enzymes [BR:cff01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CFF8240_1032
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CFF8240_1032
Glycosyltransferases [BR:cff01003]
 Polysaccharide
  Bacterial polysaccharide
   CFF8240_1032
Peptidoglycan biosynthesis and degradation proteins [BR:cff01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CFF8240_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase HemS
Motif
Other DBs
NCBI-ProteinID: ABK81767
UniProt: A0RPR3
LinkDB All DBs
Position
1033875..1035812
Genome map
AA seq 645 aa AA seqDB search
MKHIFGFFTIIAIAIFAALIYFYSQIRVDISAIVEYKPKLTTQIFDRNGDLVANVFDEEN
RQYAKYQEIPPRVVEALVAVEDTSFFEHGGINVEAIFRAAIKDIKAMSLVEGASTLTQQL
IKNMVLTRDKKFTRKLKEVILAFKIEEDLTKEEIIERYLNQVYFGHGYYGIKTAALGYFK
KELNELTIKETAILVGLPKAPSNYDPTRHIDLSLSRANGVITRLYALGWISENEYAQALK
ETPVVYDETLTQNRAPYLVDETLKEAYKIFPDIKYGGYKITLNADLKVQEIAQNALKFGY
NEILKRDKNADQNYLNGAMIVTNPANGEILALVGGIDYAKSNFNRATQSERQPGSSFKPF
IYQIALDLGYSPMSKVADISRVFENVNRSEEDKDWKPKNYGGNFEGYITLKHALRQSRNL
ATINLLNSIGLDVVQQKLSYFGFNNIPQNLSIALGSFGVSLINFSEYYSMFAGLGEQSKS
RLIKSIESTNGTLTTYEQESSKIIDPQQAYLMIDMLKDVVNAGTGRNAKVEGIEVAGKTG
TTNNNVDAWFCGFTPEVQAIIWYGNDNNLPMRKIEGGGRTAAPVFKEFMTNYIEAFPQTK
RKFETPNGVYHKIYEGIDEIYTSTSPLPSQKTDAISTQESDGLIF
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatatttttggcttttttactataattgcaattgcgatatttgcagctcttata
tatttttactcacaaatcagagtagatatatctgccatagtagagtataaaccaaaacta
acaactcaaatttttgacagaaatggagaccttgtagctaatgtttttgacgaagaaaat
agacaatatgcaaaatatcaagagatacctccaagagttgtcgaagcattagtcgcagtt
gaagatacaagcttttttgagcatggaggtataaatgtagaagctatttttagagcagcc
ataaaagatataaaagcaatgtcattagtagaaggagcctccactttaactcaacaactg
ataaaaaatatggttctaacacgcgataaaaaatttactcgtaaattaaaagaggttatt
ttagcattcaagatagaagaagatctgaccaaagaagaaattatcgaaagatatctcaat
caagtatattttggacacggctattatggtataaaaacagcagcactcggatattttaaa
aaagagttaaatgaacttactataaaagagactgctatactagtaggactcccaaaagca
cctagtaactatgatcctactagacacatagatctatctttgtcacgtgctaatggagtt
attacaagactgtatgcattaggctggataagtgaaaacgaatacgctcaggccttaaaa
gaaactcctgtagtatatgatgagacattaacacaaaacagggctccgtatctagtagat
gaaacattaaaagaagcttataaaatatttccggatataaaatacggtggatataaaatc
acattaaatgccgatctcaaagtacaagaaatagcgcaaaatgcgcttaaatttggatat
aacgagatattaaaaagagataaaaatgcagatcaaaattatctaaacggcgctatgata
gtaactaatcctgcaaatggtgaaatactagcattagtcggaggtatcgactacgcaaaa
agtaacttcaaccgtgccacgcaaagtgagcgccaaccaggatctagcttcaagccattc
atataccaaatcgctcttgatcttggctactctcctatgagtaaagtagcagatatatca
agagtatttgaaaatgtaaatagaagcgaagaggataaagactggaaaccaaaaaattat
ggtggaaattttgaaggatacataactcttaaacatgctttaagacagtctcgtaattta
gccaccataaatcttttaaattctataggattagacgtagttcagcaaaaactttcatat
tttggttttaataatatacctcaaaatctttcaatagcacttggaagttttggagtaagc
cttataaactttagcgaatattactcaatgttcgcaggtttaggagagcagagcaaatca
aggctaataaaatccatcgaaagcacaaacggcacattaacaacatatgagcaagaaagt
tctaaaatcatagatcctcagcaggcgtatttaatgatagatatgctaaaagatgtcgta
aatgccggaaccgggcgaaatgcaaaagttgaaggtatagaagtagcaggaaagacagga
actacaaataataacgtagatgcgtggttttgcggatttactcctgaagtccaagccatt
atctggtatggaaacgataataatctacctatgagaaaaatagaaggtggcggaagaacc
gcagctcctgtattcaaggagtttatgacaaattatatagaagcatttcctcaaactaaa
cgtaaatttgaaaccccaaatggagtatatcataaaatttatgaaggcatagatgaaata
tatacaagtacttctccactgccttcacaaaaaacagatgcaatctctactcaagagagc
gatgggttaatattttaa

DBGET integrated database retrieval system