KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_1741Help
Entry
CFF8240_1741      CDS       T00430                                 

Gene name
aroC
Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
cff00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cff01100  Metabolic pathways
cff01110  Biosynthesis of secondary metabolites
cff01130  Biosynthesis of antibiotics
cff01230  Biosynthesis of amino acids
Module
cff_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cff00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFF8240_1741 (aroC)
Enzymes [BR:cff01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     CFF8240_1741 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: ABK82663
UniProt: A0RRM6
LinkDB All DBs
Position
complement(1697545..1698615)
Genome map
AA seq 356 aa AA seqDB search
MNTFGSKLRLTTFGESHGKAIGGVLDGFPAGVAIDEEFLQSEMDKRKPGGKYATSRKEAD
EVEILSGIFEGFSTGTPIGFIIKNSNQHSKDYDSIKDLFRPGHADFTYFSKFGVRDHRGG
GRSSARETAVRVAAGAFGAMMLKEFDIDIKSGVFSIGKLKSNKIDFEFASKSEIFMLDSD
IEEDAKNLILDVKNSNDSVGAATLTIINGVPAGLGEVLYDKLDARLAAAMMGINGVKGVE
IGLGSQASFILGSQNNDFMDKNGFMSNNAGGILGGISNGEPIMIKTYFKPTPSIFKDQPT
INLNGDEVTCALRGRHDPCIGIRGSVVANAMARLVISDMLLLNASSKLSNLKKIYS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgtttggaagcaagcttagactaactacatttggggagagtcacggaaaagct
atcggaggagttttggatggatttcctgccggagtagctatagatgaagagtttttgcaa
agcgagatggataaaagaaaaccgggcggaaagtacgctacaagtagaaaagaagccgat
gaagtagagatattgagcggtatttttgaaggatttagtacaggaacacctataggattt
ataataaaaaactcaaatcagcactcaaaagattatgatagtataaaagatcttttcaga
ccaggacacgcggattttacgtatttttctaaatttggagtgcgagatcatagaggcgga
ggcagaagtagcgctagagaaactgccgttcgagtagccgcaggagcttttggagctatg
atgttaaaagagtttgatatagatattaaaagtggagtttttagtataggaaaactcaaa
tcaaataaaattgattttgaatttgccagtaaaagtgagatttttatgcttgatagcgat
atagaagaggacgcaaaaaatcttatactagatgtaaaaaatagcaacgatagcgtagga
gctgctactcttactattataaatggcgttcctgctgggctaggagaggtgctttatgat
aagcttgatgctagactcgcggctgctatgatgggtataaatggagtaaaaggagtagag
ataggtttaggaagccaagctagttttattttaggaagtcaaaataatgattttatggat
aaaaacggatttatgagcaataacgcaggcggaatcttaggcggaatctcaaacggtgag
cctataatgataaaaacttattttaagccgactccaagtatatttaaagatcagcctacc
ataaatttaaacggcgatgaggtgacttgcgctttaagaggtcgtcatgatccttgtata
ggcataagaggcagcgtagttgctaatgctatggcaagactagttatatctgatatgctt
cttttaaatgctagctcaaagctttcaaatttaaaaaaaatctactcttaa

DBGET integrated database retrieval system