KEGG   Caulobacter flavus: C1707_18530Help
Entry
C1707_18530       CDS       T05702                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cfh  Caulobacter flavus
Pathway
cfh00010  Glycolysis / Gluconeogenesis
cfh00020  Citrate cycle (TCA cycle)
cfh00620  Pyruvate metabolism
cfh01100  Metabolic pathways
cfh01110  Biosynthesis of secondary metabolites
cfh01120  Microbial metabolism in diverse environments
cfh01130  Biosynthesis of antibiotics
cfh01200  Carbon metabolism
Module
cfh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cfh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C1707_18530
   00020 Citrate cycle (TCA cycle)
    C1707_18530
   00620 Pyruvate metabolism
    C1707_18530
Enzymes [BR:cfh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     C1707_18530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N PYNP_C Peptidase_M23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AYV48093
UniProt: A0A2N5CM55
LinkDB All DBs
Position
complement(4070456..4071754)
Genome map
AA seq 432 aa AA seqDB search
MSIDILMPALSPTMEEGTLAKWHVKVGDTVKAGDVIAEIETDKATMEVEAVDEGVIEAIL
VDAGTENVKVNALIAKLAGEGESPAPAPVAAPAAAVAEAPKAAAPSPAAAAAAAPAPAAP
VAADGSRVFASPLARRLASAANLDLKSIKGSGPHGRVVKSDVEAAKSGGAPAAKAAPAPA
AAASAPAAEPRKVQSLEQMGIPAGSYDLVPLDGMRKTIARRLTESFRDVPHFPLTIDIEL
DGLLAARAKINSLLEGQGVKVSVNDIVIKAAAVALKRVPEANASYTPEGIAMHKHADIAV
AVAIDGGLITPIIRAAETKGLAQISAEMKDLAARAKAKKLKPEEFQGGTFSVSNLGMFGI
KAFSSIINEPQGAIMSVGAGEQRPVVKNGQLAVATVMTVTLTCDHRVVDGAVGAKFLAAF
KPLIEEPLTLIV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcgacatcctgatgcccgccctgtcgcccaccatggaagagggcaccctcgcc
aagtggcacgtcaaggttggcgacaccgtcaaggccggcgacgtcatcgccgagatcgag
accgacaaggccaccatggaagtcgaagccgtcgatgagggcgtgatcgaagccatcctg
gtcgacgccggcaccgagaacgtcaaggtcaacgcgctgatcgccaagctggcgggcgag
ggcgagagccccgcgccggctccggtcgccgcgcccgccgccgctgtcgccgaggccccc
aaggccgccgctccgtcgcccgccgccgctgctgccgccgccccggccccggctgctccg
gtcgccgccgacggttcgcgcgtcttcgcctcgccgctggcccgccgcctggcttcggcc
gccaatctcgacctgaagtccatcaagggctcgggcccgcacggtcgcgtcgtcaagtcg
gacgtggaagcggccaagagcggcggcgccccggccgccaaggccgcgccggctccggcc
gccgctgcttcggctcccgccgccgagccgcgcaaggtgcagtcgctggagcagatgggc
atccccgccggctcctacgacctcgtgccgctggacggcatgcgcaagaccatcgcgcgc
cgcctgacggaaagcttccgcgacgttccgcacttcccgctgacgatcgacatcgaactc
gacggcctgctggccgcccgcgccaagatcaacagcctgctggaaggccagggcgtgaag
gtgtcggtcaacgacatcgtcatcaaggccgccgccgtggcgctgaagcgcgtgcctgag
gccaacgcctcctacacgcccgaaggcatcgccatgcacaagcacgccgacatcgccgtg
gccgtggccatcgacggcggcctgatcaccccgatcatccgcgccgccgagaccaagggc
ctggcccagatctcggccgagatgaaggacctggccgcccgcgccaaggccaagaagctg
aagcccgaggaattccagggcggcaccttctcggtcagcaacctcggcatgttcggcatc
aaggcgttctcgtcgatcatcaacgagccgcagggcgcgatcatgagcgtcggcgccggc
gagcagcgtccggtggtcaagaacggccagctggccgtggccacggtcatgaccgtgacc
ctgacctgcgatcaccgcgtggtcgacggcgcggtcggcgccaagttcctggcggccttc
aagccgctgatcgaggagccgctgaccctgatcgtctaa

DBGET integrated database retrieval system