KEGG   Cellulomonas fimi: Celf_1053Help
Entry
Celf_1053         CDS       T01490                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00473  D-Alanine metabolism
cfi01100  Metabolic pathways
cfi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cfi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Celf_1053
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Celf_1053
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cfi01011]
    Celf_1053
Enzymes [BR:cfi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Celf_1053
Peptidoglycan biosynthesis and degradation proteins [BR:cfi01011]
 Precursor biosynthesis
  Racemase
   Celf_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEE45190
UniProt: F4H220
LinkDB All DBs
Position
1146037..1147302
Genome map
AA seq 421 aa AA seqDB search
MSRPPGGTTPRPVVPPAGARLGAVSLYPARAVVDLAAIRGNVRSLAAHAPSAQVMAVVKA
DAYGHGLVPSARAAVEGGATWLGAAQVAEALELRRAGVVGPRVLTWLYAPGAPLADAVAA
VVDVSVAAAWALDEVVAAARVAHRTARVHLKVDTGLGRNGLTPGDLAALLPAVLRAQAEG
AVEVVGVWSHLAFADEPAHPTVRAQAGVFADAVRTVEQAGLRPEVRHLANSAATLTDPSV
HHDLVRPGIAVYGLSPVPQVGGPADFGLVPAMTFEAELATVKTVPAGQGLSYAHRYVTPQ
ETVVGIVPVGYADGVPRHASGGQDGPGGPLRVGGRTLAVAGRVCMDQVVVDLGPGACEVA
GDRVELFGTGADGGPTAQDWADAAGTIAYEIVTRVGARVPRVHVDTAAPSQGADRTQEVA
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcccgcccggggggacgacgccccggcccgtcgtgccgcccgcgggtgcgaga
ctgggcgccgtgagcctgtaccccgctcgagccgtcgtcgacctcgccgcgatccgcggc
aacgtgcgcagcctcgcggcgcacgccccgtccgcccaggtcatggccgtggtcaaggcc
gacgcgtacgggcacgggctcgtgccgtcggcgcgcgccgcggtcgagggcggcgccacg
tggctcggtgccgcgcaggtcgccgaggcgctcgagctgcggcgcgcgggcgtcgtcggg
ccgcgcgtcctgacctggctgtacgcgcccggcgccccgctcgccgacgccgtcgccgcg
gtcgtcgacgtgtccgtggccgcggcgtgggcgctcgacgaggtcgtcgcggcggcccgc
gtcgcgcatcgcacggcccgcgtgcacctcaaggtcgacacgggcctcggccgcaacggg
ctgaccccgggcgacctggcggcgctgctgcccgccgtgctgcgcgcgcaggcggagggg
gccgtcgaggtcgtgggcgtctggtcgcacctcgcgttcgcggacgagcccgcccacccg
accgtgcgcgcgcaggccggggtgttcgccgacgcggtccgcaccgtcgagcaggccggg
ctgcgcccggaggtgcggcacctggccaactcggccgcgacgctcaccgacccgtcggtc
caccacgacctggtccgccccgggatcgcggtctacgggctctcgcccgtgccgcaggtc
ggcggtcccgcggacttcgggctggtgcccgccatgaccttcgaggccgagctcgcgacg
gtgaagaccgtgccggccgggcagggcctgtcctacgcgcaccggtacgtcacgccgcag
gagacggtcgtcgggatcgtgcccgtcgggtacgcggacggcgtcccgcggcacgcgtcg
ggcgggcaggacggcccgggcgggccgctgcgcgtcgggggccgcacgctcgccgtcgcc
ggccgcgtctgcatggaccaggtcgtcgtcgacctcgggccgggtgcgtgcgaggtggcc
ggggaccgcgtcgagctgttcggcacgggcgcggacggcggcccgaccgcgcaggactgg
gcggacgccgccggcaccatcgcgtacgagatcgtcacccgcgtcggcgcccgtgtgccg
cgcgtccacgtcgacaccgcggcgccctcgcagggggcggaccgcacccaggaggtggcc
cgatga

DBGET integrated database retrieval system