KEGG   Cellulomonas fimi: Celf_1122Help
Entry
Celf_1122         CDS       T01490                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00020  Citrate cycle (TCA cycle)
cfi00480  Glutathione metabolism
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01120  Microbial metabolism in diverse environments
cfi01130  Biosynthesis of antibiotics
cfi01200  Carbon metabolism
cfi01210  2-Oxocarboxylic acid metabolism
cfi01230  Biosynthesis of amino acids
Module
cfi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celf_1122
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Celf_1122
Enzymes [BR:cfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Celf_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEE45257
UniProt: F4H2N1
LinkDB All DBs
Position
1219326..1220543
Genome map
AA seq 405 aa AA seqDB search
MAKIKVVGPVVELDGDEMTRIIWQFIKDRLIHPYLDIDLRYYDLSIQNRDATDDQVTIDA
AHAIKEHGVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNIPRL
VPGWNKPIIIGRHAHGDQYKATNFKVAGAGTLTLTFTPADGSEPIQQQVVTYPETGGVAM
GMYNFNESIRDFARASFAYGLQRGYPVYLSTKNTILKAYDGQFKDIFQEVFDEEFAAAFA
EKGLTYEHRLIDDTVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTGGLKHRGKLDGTPEVTQFAETLE
DVVITTVESGKMTKDLAALIGPEQPWLTTEEFLAALDENLAARLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtcgtcggcccggtcgtcgagctcgacggcgacgagatgacgcgc
atcatctggcagttcatcaaggaccgcctgatccacccgtacctcgacatcgacctgcgg
tactacgacctgtcgatccagaaccgcgacgccaccgacgaccaggtgacgatcgacgcg
gcgcacgccatcaaggagcacggcgtcggcgtgaagtgcgcgacgatcacgcccgacgag
gcgcgcgtcgaggagttcggcctgaagaagatgtgggtctcgccgaacggcacgatccgc
aacatcctcggcggcgtcgtgttccgcgagccgatcatcatcagcaacatcccgcgcctg
gtcccgggctggaacaagccgatcatcatcggccgtcacgcccacggcgaccagtacaag
gcgacgaacttcaaggtcgccggcgccggcacgctgacgctgaccttcacgccggccgac
ggctccgagccgatccagcagcaggtcgtgacctacccggagacgggtggcgtcgcgatg
ggcatgtacaacttcaacgagtcgatccgcgacttcgcgcgcgcctcgttcgcgtacggc
ctgcagcgcggctacccggtgtacctgtcgacgaagaacacgatcctcaaggcctacgac
ggccagttcaaggacatcttccaggaggtgttcgacgaggagttcgcggccgcgttcgcc
gagaagggcctcacctacgagcaccgcctcatcgacgacacggtcgccgcggccatgaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggcgacgtgcagtccgacacc
gtcgcgcaggggttcggctcgctcggcctcatgacgtcggtcctcatgacgcccgacggc
aagaccgtcgaggccgaggcggcgcacggcacggtcacgcgccactaccgccagcaccag
cagggcaagccgacgtcgaccaacccgatcgcgtcgatcttcgcctggaccggcggcctc
aagcaccggggcaagctcgacggcacccccgaggtcacgcagttcgcggagaccctcgag
gacgtcgtcatcacgaccgtcgagagcggcaagatgacgaaggacctcgcggcgctcatc
ggccccgagcagccgtggctgacgaccgaggagttcctcgccgcgctcgacgagaacctc
gccgcgcgcctggcctga

DBGET integrated database retrieval system