KEGG   Cellulomonas fimi: Celf_1185Help
Entry
Celf_1185         CDS       T01490                                 

Definition
(GenBank) DNA primase small subunit
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cfi  Cellulomonas fimi
Pathway
cfi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cfi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Celf_1185
Enzymes [BR:cfi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Celf_1185
DNA repair and recombination proteins [BR:cfi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Celf_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEE45320
UniProt: F4H399
LinkDB All DBs
Position
1294767..1295720
Genome map
AA seq 317 aa AA seqDB search
MGEQDETALDALAELGRGGTWEVHGRRLKVTNLDKVLFPGRPGEAPVTKRELLAYAARIA
PVVLPYLRGRALNLHRYPEGADRPGFWHKQVPSHAPDWLPRWDNPEADDGETTTYLVVDE
PAALVWAANFGALEWHAWTSRTSDPHRPTYALVDIDPGGSTTWDEVLVLARLHRDAFAHL
GVRAAPKLTGRRGVQVWVPVAAGPDFAETRAWVERLSRTVGAVVPELVSWRWEVRERGGQ
ARLDYTQNAINKTLVAPYSPRAAAGAPVSAPITWDELDAPWLRPDAFTVRTVLDRLAERG
DPFRVVLDEDQVLPRLG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgagcaggacgagacggcgctcgacgcgctggcggagctcggtcggggcgggacg
tgggaggtgcacggccgccggctcaaggtcacgaacctcgacaaggtgctgttcccgggc
cggccgggggaggcgcccgtcaccaagcgtgagctgctggcgtacgcggcgcgcatcgcg
cccgtcgtcctgccgtacctgcgcgggcgggcgctcaacctgcaccggtaccccgagggc
gccgaccggcccggcttctggcacaagcaggtgccgtcccatgcgccggactggctgccg
cgctgggacaacccggaggccgacgacggggagacgacgacgtacctggtcgtcgacgag
ccggcggcgctcgtgtgggcggccaacttcggcgctctcgagtggcacgcgtggacgtcg
cgcacgtccgacccgcaccgcccgacgtacgcgctggtcgacatcgacccgggcggctcg
accacgtgggacgaggtgctcgtgctcgcccggctccaccgcgacgcgttcgcgcacctc
ggcgtccgcgcggcgcccaagctcaccgggcgtcgaggcgtccaggtgtgggtgccggtg
gcggcgggccccgacttcgcggagacgcgagcgtgggtcgagcgtctgtcgcgcacggtc
ggcgccgtggtcccggagctcgtgagctggcgctgggaggtgcgggagcgtggcggccag
gcgcggctggactacacgcagaacgcgatcaacaagaccctcgtcgcgccctacagcccg
cgggccgccgccggggcgccggtgtcggccccgatcacgtgggacgagctcgacgcgccg
tggctgcgcccggacgcgttcacggtccgcaccgtgctggaccggctcgcggagcgcggc
gacccgttccgtgtggtcctcgacgaggaccaggtgctcccgcgcctcggctga

DBGET integrated database retrieval system