KEGG   Cellulomonas fimi: Celf_2126Help
Entry
Celf_2126         CDS       T01490                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00071  Fatty acid degradation
cfi00280  Valine, leucine and isoleucine degradation
cfi00281  Geraniol degradation
cfi00362  Benzoate degradation
cfi00592  alpha-Linolenic acid metabolism
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01120  Microbial metabolism in diverse environments
cfi01130  Biosynthesis of antibiotics
cfi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cfi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Celf_2126
   00592 alpha-Linolenic acid metabolism
    Celf_2126
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Celf_2126
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Celf_2126
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Celf_2126
   00642 Ethylbenzene degradation
    Celf_2126
Enzymes [BR:cfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Celf_2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEE46254
UniProt: F4H107
LinkDB All DBs
Position
2358452..2359690
Genome map
AA seq 412 aa AA seqDB search
MPTASARPPVARRVVFVDGVRTPFGRARKDGLYAHTRADDLVVKTVRELLRRHPDLSPER
VDEVAIAATTQQGDQGLTLGRTVGVLAGLPRTVPGYAVDRMCAGAMTAVTNVAATIGVGA
QDVAIAGGVEHMGHHPMGFEADPNPRFLSERLVAPDALNMGVTAENLHDRFPALTRERAD
AYGVASQAKYAAALAAGRIDPDLVPVALRDPERGWGLATADEPPRPGTTLDAVADLPTPF
RPGGRVTAATSAPLTDGAASCVLAAEETAAELGLPVRMRLVSFAYAGVEPEIMGVGPVPA
TRKALDRAGLTIDDIGLFEINEAFAVQVLAFLDAFGIADDDPRVNPYGGAIAVGHPLASS
GVRLMTQLARQFEEHPEVRYGVTTMCVGLGQGGTVIWENPHHADCTTDGSQQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgcatccgcccgaccgcccgtcgcccgtcgcgtcgtcttcgtcgacggggtc
cgcaccccgttcggccgtgcgcgcaaggacgggctctacgcccacacccgcgccgacgac
ctcgtcgtcaagaccgtccgcgagctcctgcgccgccaccccgacctgtcgcccgagcgg
gtcgacgaggtcgcgatcgccgcgaccacccagcagggcgaccagggcctgacgctcggc
cgcaccgtgggcgtcctcgcgggcctgccccgcaccgtgcccggctacgccgtcgaccgg
atgtgcgcgggcgccatgacggcggtgaccaacgtcgccgcgaccatcggcgtcggcgcg
caggacgtcgcgatcgcgggcggcgtcgagcacatgggccaccaccccatgggcttcgag
gccgacccgaacccgcggttcctgtccgagcggctcgtcgcacccgacgcgctcaacatg
ggcgtcacggccgagaacctgcacgaccggttccccgccctgacccgcgagcgcgccgac
gcgtacggcgtcgcgagccaggcgaagtacgccgcggccctcgccgccgggcggatcgac
cccgacctcgtgcccgtcgcgctgcgcgaccccgagcgcggctggggtctcgcgaccgcc
gacgagccaccgcgacccggtaccacgctcgacgccgtcgccgacctgccgacgccgttc
cggccgggtggccgcgtcaccgccgcgacgtccgcgccgctcacggacggcgccgcgtcg
tgcgtgctcgccgccgaggagaccgccgccgagctcggcctgccggtgcgcatgcgcctc
gtctccttcgcctacgcgggcgtcgagcccgagatcatgggcgtcgggcccgtgcccgcc
acgcgcaaggcgctcgaccgcgccggcctgacgatcgacgacatcgggctgttcgagatc
aacgaggcgttcgcggtccaggtgctcgcgttcctcgacgcgttcggcatcgccgacgac
gacccgcgggtcaacccgtacggcggcgcgatcgccgtcggccacccgctcgcgtcgtcg
ggcgtgcgcctcatgacgcagctcgcgcgccagttcgaggagcaccccgaggtccgctac
ggcgtcacgaccatgtgcgtcgggctcggccagggcggcaccgtgatctgggagaacccg
caccacgccgactgcacgaccgacgggagccagcagtga

DBGET integrated database retrieval system