KEGG   Cellulomonas fimi: Celf_2232Help
Entry
Celf_2232         CDS       T01490                                 

Definition
(GenBank) alpha amylase catalytic region
Organism
cfi  Cellulomonas fimi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: AEE46360
UniProt: F4H263
LinkDB All DBs
Position
complement(2471592..2473304)
Genome map
AA seq 570 aa AA seqDB search
MRLRDTGDLWWKNAVIYCLDVETFMDWNDDGIGDFPGLVQRIDHLADLGVTCLWLMPFYP
TADRDDGYDIVDFFAVDPRLGDAGDLVELIRTARDRGIRVIADLVVNHTSDRHPWFRSAR
RSTESPYRDFYVWSATKPPDTSDQVVFPDQESGIWTFDEATGEYYRHRFYRHQPDLNTAN
PQVRDAIAKVVGYWAEVGLSGFRVDAVPFFLADAAKGPGDEIERPHDYLKSLRAFLTRRT
GDAILMGEVNLPYEQQRQFFGDDDGDGESDGDELTMQFDFVGMQQLYLALARQDAGPLAG
ALRSRPPIPRDAQWATFVRNHDELTLDKLSEDERAEVFAALGPDPDMQLYGRGLRRRLPP
MLGGDPRRVRMVYSLLFSLPGTPVLFYGEEIGMGENLAAEGRLAVRTPMQWTSERNGGFS
RAQRGRLAGPVTEGGYGPEHVNVADQRRDPESMLTFVQTLVRRYRESPELGWATEVEILD
QPHAAVLAHRSTWQDGSTLALHNLGDESVEVPLHLPDAVPDDDGGELVRLVDLLHAEEWT
CDERGRVTVPLAGYGYRWLRVVREGSRRLL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgcgcgacacgggcgacctgtggtggaagaacgcggtgatctactgcctggac
gtcgagacgttcatggactggaacgacgacggcatcggcgacttcccggggctcgtccag
cgcatcgaccacctcgccgacctcggcgtgacgtgcctgtggctcatgccgttctacccg
acggccgaccgcgacgacggctacgacatcgtcgacttcttcgcggtcgacccccggctg
ggcgacgcgggcgacctcgtcgagctcatccgcacagcgcgcgaccgcggcatccgcgtc
atcgcggacctcgtggtcaaccacacgagcgaccgccacccgtggttccgctcggcccgg
cgcagcacggagtccccctaccgggacttctacgtgtggagcgcgacgaagccgcccgac
acgtccgaccaggtcgtcttccccgaccaggagtcgggcatctggacgttcgacgaggcg
accggcgagtactaccggcaccgcttctaccgccaccagccggacctcaacaccgcgaac
ccgcaggtccgcgacgcgatcgcgaaggtcgtgggctactgggccgaggtcgggctgtcg
ggcttccgcgtcgacgccgtgccgttcttcctcgccgacgccgccaaggggcccggcgac
gagatcgagcggccgcacgactacctcaagtcgctgcgcgcgttcctcacgcggcgcacc
ggggacgcgatcctcatgggcgaggtcaacctgccctacgagcagcagcgccagttcttc
ggcgacgacgacggcgacggcgagtcggacggcgacgagctcacgatgcagttcgacttc
gtcggcatgcagcagctgtacctcgcgctcgcccggcaggatgccgggccgctcgcgggc
gcgctgcgctcgcgtccgccgatcccgcgcgacgcgcagtgggcgacgttcgtccgcaac
cacgacgagctgacgctcgacaagctgtccgaggacgagcgggccgaggtgttcgccgcc
ctcgggcccgaccccgacatgcagctgtacggccgggggctgcgccggcggctgcccccg
atgctcggcggcgacccgcgccgcgtccgcatggtctactcgctgctcttctcgctgccc
ggcacgcccgtgctgttctacggcgaggagatcggcatgggggagaacctcgcggccgag
ggccggctggcggtccgcacgccgatgcagtggacctcggagcgcaacggcgggttctcg
cgcgcgcagcgcgggcgcctcgccgggcccgtcaccgagggcggctacgggcccgagcac
gtcaacgtggccgaccagcgacgcgaccccgagtcgatgctgacgttcgtgcagacgctc
gtgcggcggtaccgcgagagccccgagctcggctgggcgacggaggtcgagatcctcgac
cagccgcacgccgccgtcctcgcgcaccgcagcacgtggcaggacggctcgacgctcgcg
ctgcacaacctgggcgacgagtccgtcgaggtgcccctgcaccttcccgacgcggtcccc
gacgacgacggcggcgagctcgtccggctcgtggacctgctgcacgccgaggagtggacc
tgcgacgagcgcggtcgggtcacggtgccgctggccgggtacgggtaccgctggctccgc
gtggtccgcgagggcagccgccgcctgctgtga

DBGET integrated database retrieval system