KEGG   Cellulomonas fimi: Celf_2588Help
Entry
Celf_2588         CDS       T01490                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
cfi  Cellulomonas fimi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: AEE46713
UniProt: F4H5Y3
LinkDB All DBs
Position
2883475..2884536
Genome map
AA seq 353 aa AA seqDB search
MRLPVMPPVAPMLAKSVPTIPDVGHVEPKWDGFRTIVFRDGDEVELGSRNEKPMTRYFPE
LVEAIRANTPERCVLDGEIVVVTGDRLDFDALQQRIHPAASRVRLLAGSTPASFVAFDLL
ALDDEDYMQRPFRDRRAALVEALADARDPVFVTPATGDLAQAQDWFTRFEGAGLDGVVAK
PLDGTYQPDKRTMFKIKHERTADCVVAGFRWHKTGDVVGSLLLGLYDDDGDLQHVGVSAS
FPMARRRTLLDDLAPYRDVELADHPWGRWAQAEAHAGNRMPGAVSRWNAKKDLSFVPLRP
ELVVEVAYDHMEGDRFRHTAQFRRWRTDRDPRSCTYAQLEQPVTFDLAEIFGR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcccgtgatgccgcccgtcgcgcccatgctcgcgaagtccgtgccgaccatc
cccgacgtggggcacgtcgagccgaagtgggacgggttccgcacgatcgtgttccgcgac
ggcgacgaggtggagctcggcagccgcaacgagaagcccatgacgcgctacttcccggag
ctcgtggaggcgatcagggcgaacaccccggagcgctgcgtgctggacggggagatcgtc
gtcgtgacgggtgaccggctcgacttcgacgcgctgcagcagcgcatccacccggcggcg
agccgcgtccggctgctcgcgggcagcacgcccgcgagcttcgtggcgttcgacctgctg
gcgctggacgacgaggactacatgcagcgcccgttccgcgaccgccgcgcggccctcgtc
gaggcgctcgccgacgcgcgcgacccggtgttcgtcacgcccgcgaccggcgacctggcg
caggcgcaggactggttcacgcgcttcgagggggcgggcctggacggggtggtcgccaag
ccgctcgacgggacctaccagccggacaagcgcacgatgttcaagatcaagcacgagcgc
acggcggactgcgtggtcgccggcttccgctggcacaagacgggggacgtcgtcggctcg
ctcctgctcgggctgtacgacgacgacggcgacctgcagcacgtgggcgtgagcgcgtcg
ttcccgatggcgcgccgcaggacgctgctcgacgacctggcgccgtaccgggacgtcgag
ctggccgaccacccgtggggccgctgggcgcaggcggaggcgcacgcgggcaaccggatg
ccgggagcggtgagccgctggaacgccaagaaggacctgtcgttcgtcccgctgcgtccc
gagctcgtggtcgaggtcgcctacgaccacatggagggcgaccggttccggcacaccgcg
cagttccgtcgctggcgcacggaccgcgacccgcgctcgtgcacgtacgcgcagctcgag
cagccggtcacgttcgacctggcggagatcttcggccgctga

DBGET integrated database retrieval system