KEGG   Cellulomonas fimi: Celf_2870Help
Entry
Celf_2870         CDS       T01490                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00020  Citrate cycle (TCA cycle)
cfi00190  Oxidative phosphorylation
cfi00650  Butanoate metabolism
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01120  Microbial metabolism in diverse environments
cfi01130  Biosynthesis of antibiotics
cfi01200  Carbon metabolism
Module
cfi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cfi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celf_2870
   00650 Butanoate metabolism
    Celf_2870
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Celf_2870
Enzymes [BR:cfi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Celf_2870
    1.3.5.4  fumarate reductase (quinol)
     Celf_2870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 HI0933_like DAO Pyr_redox_2 FAD_binding_3 GIDA
Motif
Other DBs
NCBI-ProteinID: AEE46992
UniProt: F4H831
LinkDB All DBs
Position
3205602..3207452
Genome map
AA seq 616 aa AA seqDB search
MQTHQYDVVIVGAGGAGMRAALESSTRVRTAVISKLYPTRSHTGAAQGGMCAALANVEED
NWEWHTFDTVKGGDYLVDQDAAEVMAKEAIDAVLDLEKMGLPFNRTPEGRIDQRRFGGHT
RNHGEAAVRRSCYAADRTGHMILQTLYQQCVKNDVEFFNEFYVLDLLVDHDLAAGHVPDG
EQVNVSGVVAYELATGEIHVFQAKSVVLATGGAGKIFKTTSNAHTLTGDGMALAYRRGIP
LEDMEFFQFHPTGLAGLGILLSEAARGEGGILRNAQGERFMERYAPTIKDLAPRDIVARS
MANEVREGRGAGPNKDYVLLDLTHLEPAHIDAKLPDITEFARTYLGVEPYTEPVPVYPTA
HYAMGGVPTNIEGEVLRNATDVIRGLYAAGEVACVSVHGSNRLGTNSLLDINVFGKRAGI
SAAAYAATAAWVELPEDPAATVVAGLEEIRTRPDGERVADIRRALQETMDANAQVFRTEE
SLEQALSDLKALRKRFQSVSVQDKSRTFNTDLLEAVELGFLLDIAETVVVGALNRKESRG
GHFREDYPDRDDKGYMRHTMAYRRPLPAEGHRLWGKDSDGDHKGSFAHTTVFDDYQLVLG
SKPVTVTRYQPMERKY
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcagacccaccagtacgacgtcgtcatcgtcggcgccggcggcgccggcatgcgcgcc
gccctcgagtcctcgacgcgcgtccgcaccgccgtcatctccaagctctacccgacgcgc
tcccacacgggcgccgcgcagggcggcatgtgcgccgcgctcgcgaacgtcgaggaggac
aactgggagtggcacacgttcgacaccgtcaagggcggcgactacctcgtcgaccaggac
gccgccgaggtcatggccaaggaggccatcgacgcggtgctcgacctggagaagatgggc
ctgccgttcaaccggacgcccgagggtcgcatcgaccagcgccggttcggcgggcacacc
cgcaaccacggcgaggcggccgtgcgccggtcctgctacgccgcggaccgcacgggccac
atgatcctgcagacgctctaccagcagtgcgtgaagaacgacgtcgagttcttcaacgag
ttctacgtgctcgacctgctggtcgaccacgacctcgccgcgggccacgtgccggacggc
gagcaggtcaacgtgtcgggcgtcgtggcctacgagctcgcgaccggcgagatccacgtg
ttccaggccaagtccgtggtcctcgcgaccggcggtgcgggcaagatcttcaagacgacg
tccaacgcgcacacgctcaccggtgacggcatggcgctcgcgtaccggcgcggcatcccg
ctcgaggacatggagttcttccagttccacccgacgggcctggcgggcctgggcatcctg
ctgtcggaggccgcgcgcggcgagggcggcatcctgcgcaacgcgcagggcgagcggttc
atggagcgctacgcgcccaccatcaaggacctggcaccgcgcgacatcgtcgcccggtcc
atggcgaacgaggtccgggagggccgcggcgccggtccgaacaaggactacgtgctgctc
gacctcacgcacctcgagcccgcgcacatcgacgccaagctgcccgacatcacggagttc
gcgcgcacctacctcggcgtcgagccgtacaccgagccggtccccgtctacccgacggcg
cactacgcgatgggcggcgtgccgacgaacatcgagggcgaggtcctgcgcaacgcgacc
gacgtcatccgcggcctgtacgccgcaggcgaggtcgcgtgcgtgtcggtgcacggctcc
aaccggctcggcaccaactcgctcctcgacatcaacgtgttcggcaagcgcgccggcatc
tccgccgccgcctacgccgccaccgccgcgtgggtcgagctgcccgaggaccccgccgcg
accgtcgtcgccgggctcgaggagatccgcacccggcccgacggcgagcgcgtcgcggac
atccgtcgtgcgctgcaggagacgatggacgccaacgcgcaggtgttccgcaccgaggag
tcgctcgagcaggcgctctccgacctcaaggcgctccgcaagcggttccagtcggtgagc
gtccaggacaagagccgcacgttcaacaccgacctgctcgaggccgtcgagctcggcttc
ctgctcgacatcgccgagaccgtcgtcgtcggggcactcaaccgcaaggagtcgcgcggc
gggcacttccgggaggactacccggaccgcgacgacaagggctacatgcggcacaccatg
gcgtaccgccggccgctgcccgccgagggccaccgcctgtggggcaaggactccgacggc
gaccacaagggctcgttcgcgcacaccacggtgttcgacgactaccagctcgtgctcggg
tccaagcccgtcaccgtcacccgctaccagccgatggagcgcaagtactga

DBGET integrated database retrieval system