KEGG   Cellulomonas fimi: Celf_2871Help
Entry
Celf_2871         CDS       T01490                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00020  Citrate cycle (TCA cycle)
cfi00190  Oxidative phosphorylation
cfi00650  Butanoate metabolism
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01120  Microbial metabolism in diverse environments
cfi01130  Biosynthesis of antibiotics
cfi01200  Carbon metabolism
Module
cfi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cfi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celf_2871
   00650 Butanoate metabolism
    Celf_2871
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Celf_2871
Enzymes [BR:cfi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Celf_2871
    1.3.5.4  fumarate reductase (quinol)
     Celf_2871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_18 Fer4 Fer4_16 Fer4_4 Fer4_15 Fer4_6 Fer4_20 Fer4_2 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AEE46993
UniProt: F4H832
LinkDB All DBs
Position
3207452..3208213
Genome map
AA seq 253 aa AA seqDB search
MTATLDATPEVGAVPSFEVTLKVMRYLPADDGSAPVPHWDEFRVQAHGTDRVLDALHKVK
WEQDGSLTFRRSCAHGICGSDAMRINGRNRLACKTLLKDLDPSKPITVEPIKGLPVVKDL
VVDMEPFFASYREIMPFLITTGTEPTKERRQSAEQRERFDDTTKCILCAACTSSCPVFWT
DGQYFGPAAIVNAHRFIFDSRDEGGAQRLEILNDKEGVWRCRTTFNCTEACPRGIEITKA
IQEVKRAMITRAF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgactgccacgctcgacgccacccccgaggtcggggccgtgccctcgttcgaggtcacg
ctcaaggtcatgcgctaccttcccgccgacgacggctccgcgcccgtcccgcactgggac
gagttccgtgtgcaggcgcacggcaccgaccgcgtcctcgacgcgctgcacaaggtcaag
tgggagcaggacggctcgctgacgttccgcaggtcgtgcgcgcacggcatctgcgggtcc
gacgccatgcgcatcaacggccgcaaccgcctcgcgtgcaagacgctgctcaaggacctc
gacccgtccaagccgatcaccgtcgagcccatcaagggcctgcccgtggtcaaggacctc
gtggtcgacatggagccgttcttcgcgtcgtaccgcgagatcatgccgttcctcatcacg
accgggaccgagccgaccaaggagcgccgccagtccgccgagcagcgcgagcggttcgac
gacacgaccaagtgcatcctgtgcgcggcctgcacgtcctcgtgcccggtcttctggacc
gacgggcagtacttcgggcccgcggcgatcgtcaacgcccaccggttcatcttcgacagc
cgcgacgagggcggcgcgcagcgcctggagatcctcaacgacaaggagggcgtgtggcgc
tgccgcacgaccttcaactgcaccgaggcgtgcccccgcgggatcgagatcacgaaggcg
atccaagaggtcaagcgcgcgatgatcacgcgcgccttctga

DBGET integrated database retrieval system