KEGG   Colletotrichum fioriniae: CFIO01_00348
Entry
CFIO01_00348      CDS       T04796                                 

Definition
(GenBank) nitric oxide synthase
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00220  Arginine biosynthesis
cfj00330  Arginine and proline metabolism
cfj01100  Metabolic pathways
cfj01110  Biosynthesis of secondary metabolites
cfj04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CFIO01_00348
   00330 Arginine and proline metabolism
    CFIO01_00348
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CFIO01_00348
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     CFIO01_00348
SSDB
Motif
Pfam: NO_synthase Flavodoxin_1 FAD_binding_1 NAD_binding_1 DUF1707
Other DBs
NCBI-ProteinID: EXF78353
UniProt: A0A010S1D9
LinkDB
AA seq 1072 aa
MACPFLQGTLAQPPRQISAEQEFANIRSQYPSLSSTGCTTKFCQSGRMTHMDEERVGRNQ
SYAQVREDALDFLQQMYKDGLIDTEQLHHRAHEVLQEIQKNSTEGKFTTASECGSEAPPA
ATVGLVGGLWTQTFEELEFGLRTAWKHARKCIMRSEYSNLRLCDLRHVRTSKKMAETLIE
NLRVAYNSGEINPTVFVFPPRDIDSRGPMIWNSQLLSFAGYQQSNGTILGDPANVELTNA
IIELGWTPPRFRSQWDLLPLVTMAEGEEPVITELPKDAFPLVHIRHPKHPELETLGLRWV
PAPALSRLGFSIGGVQYTAAPFIGWFMDAEIGVRNLADSFRYNALPQVARAIGLVDGDVD
DLPDYERLAVLSRAQLELNYATYWSFAQAGVRMSDSLGAAEQFAQFDDEHLMNNGFRLPS
DPYWLAPPQGSIIPIWHRGGSPNYQPKPLICRHAQDPIKAWRRQRQARPAARPSHHYASD
TKLNISIPVVPSISLTRPVTPVSPFGTASSPSTFLPIPPPPSQQQQQVFRPTTPLTPLSP
RGPGRRIYIGFCSSGNVAIKLCKRLCAQLQHACDIDPKLGSVVVPCTLNALPISMVEPDD
VLVIVASTTGRGEIPQNGKAFADALARNPKAISCQYAIFANGSLEYADTYNQAAMDIEEL
LSKGDAQRLIGMREADTATENPPWSVLGQFFDQVLAGLQKSSPPQDESDMSDLQRTARPV
RPFDTRPWFQAKVVGQPVLGTAADGMKRVTLDLGDREYPTMGSVWILPPNSQNKVSRVLG
ALGVQADERLSLPGEPTVGEFFQRFADLDRPFKSTQWAEWLSLPQPETLAKVPIENVVHQ
IPANWRQSVTLDALCNAMPTIQPREYSIASDGSRTKQKNGNTMDLLVQHHPNGRFSDKYL
NCFETFGAATCKIRPSSHLQAMAENQDKPMIVFTTGSGMAPVRGLLQNRLQRLRSSGDKS
AKGPAISLFAGFKAADESLVREAVQEASEAGILDILRLTGSNKEKRRAQDAMLEAGVREK
LAKSIEDGALVFACARPRAVDDFLNNLSEVLGRDAREVLGDRFVADVYQPAT
NT seq 3219 nt   +upstreamnt  +downstreamnt
atggcgtgcccgttccttcaaggcacactcgcccagccgccgcggcaaatctcagcggaa
caagagttcgccaacatccgctcacaatacccttctctatcttcaacgggctgcacaaca
aagttttgccagtccggtcggatgacgcacatggacgaggagcgtgttggccggaatcag
tcatacgcccaagtccgcgaagatgcgctcgacttcctccagcaaatgtacaaggacggt
ctcattgatacggagcaactccatcatcgggcacacgaggtcctccaggagattcaaaag
aactcaacagagggcaagttcacaacggcgtccgaatgcggatcagaggcgccaccggca
gcaacggttggcttggtgggtggcctgtggacacaaacttttgaagaactcgagttcggt
ctccggacggcttggaagcatgctcggaaatgcatcatgcgatcagagtacagcaacttg
aggctatgcgacctgagacatgttcgaacaagcaaaaagatggccgagactctcattgag
aacttgagagtggcatataactcgggtgaaatcaacccgacagtcttcgtcttccctccc
agagacattgacagccgcggacccatgatctggaactcacaactcttgtcctttgcaggg
taccaacaatcaaacggcacaatcctcggagaccccgccaacgtggaactcacaaacgcc
atcattgaactcggctggacgccgccgcgcttccgctcacaatgggatctgctccctctc
gtcaccatggctgagggagaagagcccgtcatcaccgagcttcccaaggacgcattccct
ctggtgcatatccgccaccccaagcaccccgagctcgagacccttggcctgcgttgggtt
cctgcgccggcactcagccgccttggcttcagcatcggcggcgtgcaatacaccgcggcg
ccctttattggatggttcatggatgccgagatcggtgttcgcaatctcgcagattccttc
cgctacaacgcgcttccacaggttgccagggcgattggcttggtcgacggcgatgtagat
gacctcccagactacgagcgtctagcggtgttgtcccgcgcgcagctcgagctcaactac
gccacatactggtccttcgctcaagcgggtgtccgaatgtcagattcccttggcgcggcc
gagcagttcgcccagttcgatgacgagcacctcatgaacaacggcttccgcctcccctct
gacccgtactggctggcgccgcctcaagggtccatcatccccatctggcaccgcggcggc
tcgccaaactaccagccgaagcccttgatctgccgccacgcccaagatcccatcaaggcc
tggcgccggcaacgacaggcccgccccgcggcgcggccttctcaccactacgcctcggac
acgaagctcaacatctccatccccgtggtgccgtccatctccctcacgaggcccgtcacg
ccagtctcccccttcggcaccgcctcctccccgtcgacctttctccccatccctcctccg
ccctcgcagcagcagcagcaggtattcaggcccaccacgcccctgacgccgttgagcccc
cgggggcccgggcgcaggatctacatcggattctgcagctcgggcaacgtcgcgatcaag
ctttgcaagaggctgtgcgcgcagctgcagcacgcttgcgacatcgaccccaagttgggg
tccgtcgtggtgccgtgcacgcttaatgccttgcccatctccatggttgagcccgatgac
gtgctggtcatcgtagccagcacgacaggtcgtggtgagattccgcaaaatggcaaggcc
ttcgccgacgcgctggcgaggaatcccaaggccatctcgtgccagtatgccatctttgca
aacggctcactggagtacgccgacacatacaaccaggccgccatggacattgaggagctc
ctaagcaaaggagacgcccagaggctcattggcatgcgcgaggccgacaccgcgacagag
aaccctccctggtccgtcctcggccagttcttcgatcaggttctcgcggggctccaaaag
tcgagcccgccacaagatgagagcgatatgagtgacttgcagcggaccgctcgcccggtc
agaccttttgacacccgcccgtggtttcaggccaaggtcgtcggacagcctgtcttgggg
accgccgcggacggcatgaagagggtcaccctcgacctgggcgatcgcgagtaccccacc
atgggcagcgtttggattctgccgccaaactcccagaacaaggtgtcgcgcgtcctgggc
gctctcggcgtgcaggctgacgagcggctgagtcttcccggtgagcctaccgtgggagag
ttcttccagcggtttgcggacttggatcggcccttcaagtccacgcagtgggcagagtgg
ctgtctcttcctcagcccgagaccctggccaaggtccctatcgagaatgtggtccaccag
attcctgccaactggagacagtccgtgacgctggatgcgctgtgtaacgcgatgcctacg
atccagcctagggaatactccatcgcctccgatggttcgaggacgaagcaaaagaatgga
aacaccatggatcttctggtacagcaccaccccaacggcagattctcggacaagtatctc
aactgcttcgagacgtttggtgccgcaacctgcaagatccgcccttcatcgcacctgcag
gccatggccgagaaccaggacaagcccatgatcgtcttcacgacgggatccggcatggct
cccgtccgcggcctcctccagaaccgtctccagcgtcttcgttcctcgggcgacaagtcc
gccaagggtcccgcgattagcctcttcgccggcttcaaggcggccgacgagtctctcgtg
cgcgaagcggtgcaggaagcaagcgaggcaggaatcctcgacatcttgaggctgacgggg
agtaacaaggaaaagaggagggcgcaggatgcgatgctcgaggctggcgtcagggagaag
ctggccaagagcatcgaggatggcgctcttgtgtttgcgtgcgctcgcccgagggccgtt
gatgatttcttgaataatttgagtgaggtgttgggtcgggatgctagggaggtgttgggc
gatcggtttgttgctgatgtttatcagcctgctacttga

DBGET integrated database retrieval system