KEGG   Colletotrichum fioriniae: CFIO01_00483Help
Entry
CFIO01_00483      CDS       T04796                                 

Definition
(GenBank) glycosyl hydrolase family 15
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00500  Starch and sucrose metabolism
cfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFIO01_00483
Enzymes [BR:cfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CFIO01_00483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-ProteinID: EXF75998
UniProt: A0A010RUS6
LinkDB All DBs
AA seq 611 aa AA seqDB search
MSLTKTLFCAVGFAANVARIAAADLDDFISSQRTIALNGVLSNIGPDGASVTGASAGIVV
ASPSKADPDYFFTWTRDAALTMKMIVDEFILGHDELQVHIEDYYKSQAVLQTVGNPSGSF
LPSGRGLGEAKYLVDGSRFNGEWGRPQRDGPALRAITLITYSRWLIDNGQEAKAKDIIWP
IISNDLSYTAQYWNSTGFDLWEEVNGSSFFTTQNQYRALVEGAALAESLGATCTGCELAP
DVLCFLQTYWNAADGYYVANVNTQTKRSGKDANVMLGSIAVFDVAASCEDPSIQPCHSKA
LSNFKVWVDSFRNGTLYPVNEGIAQGQGVALGRYIEDTYYNGNPWYLITLGAAEFLYDAV
AQWNAHGQIKVDATSLPFFKELYPTARETTYQKNSNSTLDYAGIVKAVNAYADSFVEVAQ
KYTPADGALAEQFNKTTGSPTSARDLTWSYAAFITMAERRAGQYPPSWVPETASEVPSTC
AASTTTGVYVPATAAGAPDVTGSCTVPVTFLVNATTYYGEGLSLLGNIAELGSWNVNNGQ
SMSASGYTAERPLWSVDVELPGGSNVSYVYVRRQSCGFLYEERNRTLTVPACNSTQKVVT
DDAWVGRTNGC
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagtctaacaaagacactgttctgtgccgttggcttcgccgccaacgttgcgcgcatt
gccgccgctgatctcgacgacttcatttccagtcaaagaaccatcgcgctcaatggtgtt
ttgagcaacatcggacctgacggcgcttcggttacaggcgcaagcgccggcatcgtcgtt
gccagcccgtccaaggccgaccccgactacttcttcacgtggactcgcgatgctgccctg
accatgaagatgatcgtcgacgagttcattctcggacacgacgagctccaggttcacatt
gaggactactacaagtcccaggccgttctgcagaccgtcggcaacccttccggatcgttc
ctcccgtccggccgtggcctcggcgaggcaaagtacctggtcgacggctcgcgcttcaac
ggcgaatggggtcgcccgcagagagacggtccggcgttgagggccatcacgctcatcacc
tactcccgctggctcatcgacaacgggcaagaggccaaggccaaggatatcatatggccc
atcatctccaacgatttgtcgtacaccgcccagtactggaactcaaccggtttcgacctg
tgggaggaggtcaacggctccagcttcttcaccacccagaaccagtaccgcgcactcgtt
gagggagccgcgctggccgagtccctcggcgcaacctgcacgggatgtgagctggccccg
gacgtcctttgctttctccagacgtactggaacgccgcggacggctactacgtcgccaac
gtcaacacgcagacgaagcgctccggcaaggacgccaacgtcatgctcggctcgattgcc
gtctttgacgtggcggcgagctgcgaggacccgtccatccagccgtgccacagcaaggcc
ctgagcaacttcaaggtctgggtcgattccttccgcaacggcacgctgtaccccgtcaac
gagggcatcgcgcagggtcaaggtgttgctctcggtcggtacatcgaggacacgtactat
aatggcaacccttggtacctcatcaccctcggcgccgccgagttcctctacgacgcagtg
gcgcagtggaatgctcacggccagatcaaggtcgacgcgacctccctccccttcttcaag
gaactctacccgaccgccagggagacgacctaccagaagaacagcaactcgaccctcgac
tacgccggcatcgtcaaggccgtcaacgcctacgccgactcctttgtcgaggtcgcgcaa
aagtacaccccggccgacggcgccctcgccgagcagttcaacaagaccaccgggtccccg
acctcggcccgcgacctcacctggtcctacgccgccttcatcaccatggccgagcgccgc
gccggccagtacccgcccagctgggtacccgagaccgcgtcagaggttccctctacctgc
gccgcctcgaccacgaccggcgtctacgtccccgccaccgccgccggcgcgcccgacgtc
acgggttcctgcaccgtgcccgtcaccttcctggtcaacgcgaccacctactacggcgag
ggcctctctctgctcggcaacattgccgagctcggctcgtggaacgtcaacaacggacaa
tccatgtcggcgtccgggtacaccgccgagcgcccgctctggagcgtcgacgtcgagctc
cccggcgggtccaacgtcagctacgtctacgtgcggcgccagagctgcggcttcctctac
gaggagaggaaccgcacactcacggtgccggcatgcaactctacgcaaaaggtggtcacg
gatgatgcgtgggttggacggacgaatggttgctaa

DBGET integrated database retrieval system