KEGG   Colletotrichum fioriniae: CFIO01_01791Help
Entry
CFIO01_01791      CDS       T04796                                 

Definition
(GenBank) eukaryotic translation initiation factor 3 subunit 8
  KO
K03252  translation initiation factor 3 subunit C
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    CFIO01_01791
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cfj03012]
    CFIO01_01791
Translation factors [BR:cfj03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    CFIO01_01791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI DASH_Ask1 PSII_Pbs27
Motif
Other DBs
NCBI-ProteinID: EXF82332
UniProt: A0A010QQG0
LinkDB All DBs
AA seq 867 aa AA seqDB search
MSRFFRGGDDSSTDSSSDEEELYSEEEEEEEQQDQEDSDEEEEEDDSDSDSDDSDGGKKA
GASRFLRDASSESEDSEDEERVKVKSAKDKRIEELEATIKLIENGQKIGDWASISTEFDK
LNRQVTKLQEGGKTPKVYIKAVAELEEYMNEAIAKQKVTPAKKGMNATSARGLNAVKQKI
KKIVKDYQSQVDAYKADKDAFMESEEEEEKPAPKAKKTARFVDTTEEAADGDDDEGFATV
GKGGRTLQFTPESIFKHLRSIMETRGKKNTDKQEQIKIMEKLNEIANTPYQKIRVLLTLV
STRFDLGSGGASYMPVDHWKAAEKELNSLLEVLEQNKDYIVVENAEEWDDDEKPPALEKG
QKYIKVPGSIVSYVERLDDELTRSLQNIDPHTSEYIDRLTDEGALYNTVFRGMLYYEYLR
KDAELEIPQESINRIVTRRLEHVYFKPAQVVKILEDNCWKNVPSTVESVITPRDQAQDAN
NLVNVLCNYLFTNAEGILRARAMLCQVYFLALHDEYYKARDMMLMSHLQENIPNFDVLSQ
ILYNRTLVQVGLCAFRQGLVYDAQNTLQEICGSGRQKELLAQGVMIQRYSQVSPEQEKLE
KQRQLPFHMHINLELLECVYLTCSMLLEIPLLAQTGSSPDVKKRVISKTYRRMLEYHERQ
IFTGPPENTRDHVMQASKALAAGEWKKSTTFIHSIKIWDLMPNTEDIKTMLSKQIQEEGL
RTYLFTYAPFYDTLAVETLSNMFELDASKVLAIVSKMISHEELAASLDQVTSTVIFRKGV
ELSRLQSLALTLSDKASALIETNERTLEQRTQGSANAFERQGGRGGRGGRGGARGGNRGG
ARTGGNPQRQAGGTQFTGGALGAAVRG
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgatttttccgcggcggagacgacagctccaccgactcgtcttccgacgaggag
gagctttactccgaggaggaggaggaggaggagcagcaagaccaggaggactctgatgag
gaggaggaggaggatgactccgactctgattccgacgacagtgatggtggaaagaaggcc
ggtgcctcgcgtttccttcgcgatgcttcctcagagagcgaagacagcgaagacgaggag
cgggtaaaggtcaagagtgccaaggataagcgtatcgaggaactcgaggcgaccatcaag
cttattgagaacggccaaaagattggtgactgggcttccatttccacagaattcgacaag
ctcaaccgccaggtcacaaaacttcaagagggtggcaagacccccaaggtctacatcaag
gccgttgccgagctcgaagagtacatgaatgaggctattgcgaagcagaaggttactccg
gccaagaagggaatgaacgccacctctgcccgtggattgaacgccgtcaagcaaaagatc
aagaagatcgtcaaggactaccagtcccaggtcgatgcctacaaggccgacaaagatgcc
ttcatggagtccgaggaggaagaggagaagcccgcgcccaaggccaagaagactgctcgt
ttcgtcgacaccaccgaggaggctgccgacggagacgacgatgagggtttcgccaccgtc
ggaaagggtggccgcactctgcagttcactcccgagagcatcttcaagcacctgagaagc
atcatggagactcgcggtaagaagaacaccgacaagcaggagcagatcaagatcatggag
aagctcaacgagatcgccaacacaccctaccagaagatccgcgtcctcctcaccctggtc
tcgacccgcttcgacctcggttccggcggtgcctcttacatgcctgttgatcactggaag
gctgctgagaaggagctgaactctcttctcgaggtccttgagcagaacaaggactacatc
gttgttgagaacgccgaggagtgggatgatgacgagaagccccccgcgttggagaagggc
caaaagtacatcaaggtccctggaagcattgtttcctacgtcgagcgcctcgacgacgag
ctcactcgttccctccaaaatatcgacccccacacctccgagtacatcgaccgccttacc
gatgagggcgccctctacaacaccgtcttccgcggcatgctctactacgagtacctccgc
aaggatgccgagctcgagattccccaggagagcatcaaccgtattgtcactcgccgcctc
gagcacgtctacttcaagcccgcccaggttgtcaagatcctcgaggacaactgctggaag
aacgtcccctctaccgtcgagtccgtcatcaccccccgcgaccaggcccaggatgccaac
aacctcgtcaacgtcctttgcaactacctcttcaccaacgccgagggtattctccgcgct
cgtgctatgctgtgccaagtttacttccttgccctgcacgacgagtactacaaggctcgt
gacatgatgcttatgtctcacttgcaagagaacatccccaacttcgacgtcctctcccaa
atcctctacaaccgtacccttgtccaggtcggtctctgtgctttccgccagggtctcgtc
tacgacgcccagaacacactgcaggagatctgcggcagtggtcgtcagaaagagctgctc
gctcagggcgttatgatccagagatacagccaggtttcacccgagcaggagaagctcgag
aagcagcgccagctgcccttccacatgcacattaacctcgagcttctcgagtgcgtgtac
ctcacctgcagcatgctgctggagatccccctcctggcacagactggctcctcccccgac
gtcaagaagcgtgttattagcaagacttaccgccgcatgctcgagtaccacgagcgccag
atcttcaccggcccccccgagaacacaagagaccacgtcatgcaggcttccaaggccttg
gctgctggcgagtggaagaagtccaccacctttatccacagcatcaagatctgggacctg
atgcccaacaccgaggacatcaagaccatgctctccaagcagatccaggaggagggtctg
cggacatacctcttcacctacgctcccttctacgacaccctggccgtggagactctgagc
aacatgttcgagctggacgccagcaaggtcctcgcgatcgtcagcaagatgatcagccac
gaggagctcgcggcgtccctcgaccaggtcacatcaaccgtcatcttccgcaagggcgtc
gagctcagccgtttgcagagcctcgccctcaccctctcagacaaggccagcgcgctcatc
gagaccaacgagcggacactggagcagcgcacccagggctctgccaacgcgttcgagaga
cagggcggccgtggcggccgtggaggacgcggtggcgcgaggggcggcaacagaggaggc
gcgaggacgggcggcaacccccaacggcaggccggcggcactcagttcacgggcggcgcg
ttgggtgccgcggtccggggttga

DBGET integrated database retrieval system