KEGG   Colletotrichum fioriniae: CFIO01_01820Help
Entry
CFIO01_01820      CDS       T04796                                 

Definition
(GenBank) alpha amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00500  Starch and sucrose metabolism
cfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFIO01_01820
Enzymes [BR:cfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CFIO01_01820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: EXF82360
UniProt: A0A010R0T5
LinkDB All DBs
AA seq 575 aa AA seqDB search
MRNQVTASRPSTGQPIEVRIITTEPRATEVRAKEALPRSKSFHQLSSRVEVRPTESLPRT
KSHQLPRQERSQNPVQLQAFEWNLPADHKHWRRLRRALPALRSVGVNSLWLPPGSKAKDP
ESNGYDIYDAWDLGEFDQKGSVPTKWGTKGDLVSLAADAEHHGIGLVWDAIHNHRAYADG
TEMVKVVEVDPRDRRRDTTDVYEIESWTKFDYKARGGKYSKFRYNKSHFNGTDWNQQNKK
RAIYRFVEDGKNWHQDVGDLQGNADYLMLENLDYTNPEVVKEQHQWGKWIVDELGLKGFR
VDAVQHISWNFISKWAEHLRKPAIRNDLIFIGEFWHGDVRVLNNWLEHMPAFFSLYDVPL
MYHIERLSWHRDTDLRQVFKDTLVEQRPNNAVTFIRNHDTQKGQQMDTPICKEFMPFAYS
MILLRRDGHPCVFFGDLYGIELTHPEAPIQDLPNLLLARKLYAYGEQQDYFERPDCIGWV
RQGTEERPAGMAVVMSWTQAEHTDTRLSMLVGADHAGEVWTDVLGMESAAVTIDENGVGS
FYCPKNKMACFVNADAKGRKKFPVKFDSDFHGLIE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaccaagttacagcttcgcggccgagcaccggtcagccaattgaggttcgcatt
ataactacagaaccccgagctactgaagttcgagccaaagaggctttgccgaggagcaag
tcatttcaccagctttcttcccgtgtggaagttagaccaacagagtcccttccgcggacc
aagtcccatcaattacctcgccaggagagatctcaaaacccggtacagctacaggccttt
gagtggaatttgcccgccgaccacaagcactggcgacggctccggcgcgcgttgccggcg
ctgaggtccgttggtgttaacagcctatggctgccgcccggaagcaaagccaaggatccc
gagagtaatggctacgacatttacgacgcctgggatttaggagagtttgaccaaaagggc
tcagtccccaccaaatggggaaccaagggagaccttgtatccttagcggcggatgcggag
caccatggcattgggctcgtctgggacgctattcacaaccaccgcgcctacgctgacggc
actgagatggtaaaggtggtcgaggttgatccgcgtgatagacggagagacaccacagac
gtttatgagattgagtcatggaccaaattcgactataaagctagagggggcaagtacagc
aagttcagatataacaaatcacatttcaacggcacagactggaaccaacagaacaagaaa
cgtgccatctacaggtttgtagaagacggcaagaactggcatcaagacgtcggcgacctc
caaggaaatgccgactacttgatgctcgagaacctcgactacaccaaccccgaggtcgtc
aaagagcagcatcagtggggcaagtggatcgtggatgagctcggtctcaaaggcttccgc
gtggacgccgtacagcacatctcatggaacttcatcagtaaatgggccgagcacctaagg
aagccagccattcgcaatgatcttatatttattggagagttctggcatggcgatgtgcgc
gttctgaacaattggttggagcacatgccagcatttttcagcctctacgatgtgcctctc
atgtaccacatcgagagattgtcatggcaccgagacacggatttgaggcaggttttcaag
gacacactggtggaacaacgacccaacaacgccgtcactttcattcgtaatcacgacacc
cagaagggccaacagatggacactccaatctgcaaggagttcatgccctttgcctactcc
atgatccttctgagacgcgatggtcacccgtgtgtcttcttcggtgatttatacggcatc
gagcttacccatcccgaagcgcccatccaagaccttcccaacttgctcttggccagaaag
ctttacgcctacggggaacaacaagattacttcgaacggcccgactgcattggatgggtc
agacagggaacggaagagagacccgccggcatggccgtcgtcatgagctggacacaggct
gaacataccgacactcggttatcaatgttagttggtgccgaccacgccggggaggtctgg
accgatgtcctcggaatggagtcggccgcagttacgattgatgagaacggcgtgggctct
ttctactgcccgaagaacaagatggcttgtttcgtcaacgcggacgcgaagggaagaaag
aagttcccagtcaagttcgattctgactttcacggccttattgaataa

DBGET integrated database retrieval system