KEGG   Colletotrichum fioriniae: CFIO01_01863Help
Entry
CFIO01_01863      CDS       T04796                                 

Definition
(GenBank) DNA ligase I
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CFIO01_01863
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cfj03400]
    CFIO01_01863
Enzymes [BR:cfj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CFIO01_01863
DNA repair and recombination proteins [BR:cfj03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     CFIO01_01863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 RNA_ligase DNA_ligase_A_C BRCT LIG3_BRCT DNA_ligase_IV RTT107_BRCT_5 mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: EXF82403
UniProt: A0A010SCH0
LinkDB All DBs
AA seq 997 aa AA seqDB search
MSQRKRQKSPDAAAIDEEERHYAIGGTTLDELNEKYPNRPRNHSKTMRFSELFQSLFNPL
NENKKQPAGRGPPRSKKGPHGPHKPSPQEQRRHLIERFISRWRNEVGNDIYPALRLILPD
KDRDRGVYGLKENAIGKILVKLMKIDKNSEDGHNLLHWKLPGQTTFSRLAGDFAGRCFEV
LSKRPMRTEVGDMTIAEVNELLDKLAASTGELENLEVFEIFYERMNAEELMWLIRIVLKQ
MKVGATERTFLDLWHPDGEALFSVSSSLRRVCWELFDPRIRLEQENTGVTLMECFQPQLA
QFQMPSSFQKMVDYLRTTEEDPEFWIEEKLDGERMQMHMAEDPSVSGGLRFCFWSRKAKD
YTYLYGNGLKDEKGALTRHLADAFSEGVRNVILDGEMITWDPEVDKIMPFGTLKTAALAE
QNNPYNNTGPRPLYRVFDILLLNDQPLTQYTLRDRHRALEKAVKGVHRRLEIHEYESATT
PEAIEPLLRKVVAEASEGLVLKNPRSMYRLNSRNDDWLKVKPEYMSEFGESLDCVVIGGY
YGSGHRGGAISSFLCGLRVSENHIQAGANPEKCFSFFKVGGGFTAADYAEIRHRTDGKWT
TWDPKKPPVEYIELAGGDRQFERPDVWIRPSESVVVEAKAASIGNSDQFALGFTLRFPRF
RKLRTDKNWDEGLSVQEFLDLRRRVEAEAKEKTMSVENRKRKSVKRVKREVVIAGTENMP
AQFQADKSKVFEGLEFCVLSESLKPFKKTKAQLETLIKENGGQVSQRAVPQSGMILLADK
NVVKVASLVKEGQKGSGVDIIRPKWIQDCLEQADDSLLVPYEERHLLHATEALKTVALQN
TDMYGDSYARDISLVELREVLNMMPKKEPDTEPFNKTQFLNQLEERGRGVGPMKGSMFHR
CAVHLVNVEEGDEDEIKMLKLRNYLTFGGARLISDVDDTEATHMVVVGADTRRKDAAAAL
REEVSRRRKIPHIVTAEWIEDCWREKTLLDEEKYTRV
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgcaagcgacaaaagtcgccagacgcggcggcgattgatgaggaggagagg
cactatgctataggagggaccacactcgatgaactaaacgaaaagtacccaaatcgccca
cgcaatcattcaaagacgatgcgcttttcggaacttttccaaagcctcttcaatcctttg
aacgagaacaagaaacagccagccggtcgcggtccacctcgcagcaaaaagggcccccac
ggaccacacaagccatcgccgcaggaacagagacggcacctcattgagcgctttatttcc
agatggcggaacgaagtgggaaacgacatttatccggctttacggctcattctgcccgac
aaggatcgggaccgcggcgtctacggcctgaaggagaatgctattggcaaaatcctcgtc
aagctcatgaagatcgacaagaactcggaagacggccacaatctccttcactggaagttg
ccaggtcaaaccaccttctcgaggctggctggcgactttgcaggtcggtgtttcgaggtc
ctttccaagcgaccgatgcggacggaagtcggcgacatgacgattgccgaggtcaatgag
ttgctggacaaactcgctgcatccacgggagagctggagaacctagaggtctttgagatt
ttctacgagcgcatgaatgcggaggaacttatgtggttgattcgcatcgtgctcaagcag
atgaaggtcggcgcaaccgagcggacctttcttgacttgtggcatccggacggcgaggcc
ctgttcagcgtgtcgtcgagtctgcgacgcgtctgctgggagctttttgacccaaggatt
cgtctcgagcaggagaataccggtgttactctgatggaatgcttccaacctcagctggcg
cagttccagatgccatcctctttccagaagatggtcgattacctccgaaccacagaagaa
gaccccgagttctggatcgaggaaaagttggacggtgagcgcatgcaaatgcacatggct
gaagacccaagcgtttcgggagggctgcgtttctgcttctggtctcgcaaagcgaaagac
tacacctacctgtacggcaacggattgaaagacgagaagggagctctgactcgccatctg
gcagacgccttttccgagggtgtccgaaatgtcatcctggatggggagatgattacttgg
gacccggaagtcgacaagatcatgccgttcggcactctcaaaacagccgctttagccgag
cagaacaacccttacaacaacacagggccgcgaccgctctaccgcgtctttgatatcctc
ctgctgaacgatcagcccctgacccagtacacgctgcgggaccgtcaccgtgccctagaa
aaggctgtgaagggtgttcacaggaggctggagatccacgaatacgagtctgcgacgaca
cccgaggccatcgagccgctcctccgcaaagtggtcgccgaggcatcagagggcttggtc
ctcaagaacccgaggtccatgtacagactcaacagccgcaacgacgactggctgaaagtc
aagccggagtacatgtccgagttcggagagtctctagattgtgtcgttattggcggttac
tacggctctggacacaggggtggcgccatctccagcttcttatgtggcctgcgtgtcagc
gaaaaccacattcaagccggtgcaaaccccgagaagtgcttcagcttcttcaaggtcggt
ggcggcttcacagcggccgactatgcagagatcaggcatcggacggacgggaagtggacc
acgtgggacccgaagaagcctccagtagaatacatcgagctcgctggcggcgaccggcaa
ttcgaaaggccagatgtttggatccgacccagcgagtccgttgtggtggaggccaaggcc
gcaagcattggtaattcggaccagttcgcactcggcttcaccctgcggttcccccgtttc
cgcaagctgagaaccgacaagaactgggacgagggcctcagcgtgcaggagttcctggac
ctacggcggagggtagaggcggaggccaaagaaaagaccatgagcgtcgagaaccgcaag
cgcaagtcagtaaagcgcgtcaagcgcgaggtcgtcatcgccgggacggagaatatgcct
gcgcaatttcaggcagataagtccaaggtattcgagggtctcgaattctgcgtcctatcg
gagtcgctcaagccgttcaagaagacaaaggctcagctcgagacccttatcaaggagaac
ggcggccaggtctctcagcgggctgttccgcaatccgggatgattctcttggcggacaag
aacgtcgtcaaggtcgcaagtctggtcaaggaggggcaaaagggcagcggcgtcgacatc
atcaggcctaaatggatccaagactgtctcgaacaggctgacgattctctgctagtcccc
tatgaggagcgacacttgttgcatgcgacggaagctctcaagactgttgctctgcagaac
acggatatgtacggggacagctacgcccgcgacatcagtcttgtcgagctgcgcgaggtc
ctcaacatgatgccgaagaaagagcccgatacggagccttttaacaagacgcaatttctc
aatcagctcgaggaacgtggccgaggggtgggtccgatgaagggatcaatgttccatcgt
tgcgccgttcacctggtcaatgttgaagaaggggacgaggacgagatcaagatgttgaag
cttcggaactatctgacctttggcggcgcacgcttgatcagcgatgttgacgacacagag
gccacacacatggtcgtggtaggagctgacacccgaaggaaagatgcggccgctgcttta
cgagaggaagtcagtcggaggcgtaagattccccacatagtgactgcggaatggattgaa
gattgttggcgagagaagacactgctggacgaggagaagtatacgcgagtgtga

DBGET integrated database retrieval system