KEGG   Colletotrichum fioriniae: CFIO01_07028Help
Entry
CFIO01_07028      CDS       T04796                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00620  Pyruvate metabolism
cfj01100  Metabolic pathways
cfj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFIO01_07028
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     CFIO01_07028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-ProteinID: EXF83132
UniProt: A0A010QSJ7
LinkDB All DBs
AA seq 667 aa AA seqDB search
MSMASYPFSSASSSDISTPRSSSPSPSSVASARSSRSSISNKRMSMSSRRMTDFNPMSSV
DISVIEDKMRMASLDQHRGYSQNTFGEVQQYRNTEYVPKTQATAFQILREPLWNKGLSFT
PEERVTRNLTGLIPHTMESLQTQCQRAMKMINTRQTDVDKYLYLSSLKAQNFDLFYRLLI
DNVRELMPLVYTPTIGDVCLQYSTLYTRPEALYISIKQRKSIRTMLRNWPYPNPQICVVT
DGSRILGLGDLGVNGVGISIGKLALYTGAAGIHPENTLPIVLDTGTNNETNLKDPFYLGI
RSKRVSVAEQQAFMDEFMEAVTEVYPEMTVQFEDFESEKAFNYLDRYRNKYRCFNDDIQG
TGAVVLAGYINAVELSGVPLEEQRLVFMGAGSAGVGVAKQLVEYYTKRGLSEQVARDKFW
LVDTKGLVTKDRGDKLAEHKKYFARTDNNGHQFRTLEEVIEYVKPTALVGLTATFGVFTE
SVVRALKASVDSGGLGRRPVLFPLSNPLTKAECTFEQAVQWTDGTVIFASGSPFSPFTMK
SPDGQAITYHPNQGNNVYVFPGLGLGAILAKASKVTDDMVYTSAAALAASLNVDEIHKGL
IYPRIERVRDASVIVAREVMKSARRAGVSKLPESQWVEWEEWGDVALDAWIKERVYDPVS
FSEKSRI
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatggcgtcgtatcccttcagttcagccagctcctcagacatctctacgccccgg
tcctcttcgccttcgccatcgtccgtcgcctctgcccgctcctcccgctcctctatatct
aacaagcgcatgtccatgtccagtcgcagaatgacagacttcaaccccatgtcttccgtc
gacatctccgtcattgaagacaagatgagaatggcctccctcgaccagcaccgtggctac
tcccagaacacttttggcgaggttcagcaataccgcaacacggaatacgtgcccaagacc
caggccaccgctttccaaatcctgcgcgagcccctctggaacaaaggtctctctttcacg
cccgaagagcgcgtcaccagaaacctcaccggcctcatccctcacaccatggagagcctc
cagacgcaatgccagcgggccatgaagatgatcaacacccgccagaccgacgttgacaag
tacctctacctgtcctcgctcaaggcccaaaactttgacctcttctaccgcctgctcatt
gacaacgtccgcgaactcatgcccttggtctacacccccaccattggcgatgtctgcctg
caatactctaccctctacacccgccccgaggctctgtacatttcgattaagcagcgaaag
tccatccgcaccatgctccgcaactggccctaccccaacccccagatctgcgtcgtcacc
gacggttcccgcattctgggtcttggcgacttgggtgtcaacggtgtcggtatctctatt
ggcaagcttgctctgtacactggtgccgccggtatccaccccgaaaacaccctgcccatt
gtcctcgacaccggcaccaacaacgagaccaacctcaaggaccccttctacctgggcatc
cgctccaagcgtgtgtctgtcgccgagcagcaggcgttcatggacgagttcatggaggcc
gtcaccgaggtctaccccgagatgactgtccaattcgaagattttgagtccgaaaaggct
ttcaactacctcgaccgctaccgcaacaagtaccgctgcttcaacgacgacatccaggga
actggtgccgtcgttcttgccggttacatcaacgccgtcgagctctctggcgtccccctt
gaggagcagcgcctggtcttcatgggcgccggttccgccggtgtcggtgtcgccaagcag
ctcgtcgagtactacaccaagcgtggtctcagcgagcaggtcgccagggacaagttctgg
ctggtcgacaccaagggtctcgtcaccaaggaccgcggtgacaagctcgccgagcacaag
aagtactttgcgcgcaccgacaacaacggccaccagttccgcacccttgaggaggtcatt
gagtacgtcaagcccaccgctctcgtcggtctcactgccacctttggcgtcttcaccgag
tccgtcgtccgcgccctcaaggcctctgtcgactctggcggtcttggccgccgccccgtc
ctcttccccctcagcaaccccctcaccaaggccgagtgcactttcgagcaggccgtccag
tggaccgatggcactgtcatcttcgcctccggctcccccttctcccccttcaccatgaag
agccctgatggccaggccatcacctaccaccccaaccagggtaacaacgtctacgtcttc
cccggtctcggtctcggtgccatcctcgccaaggcctccaaggtcaccgacgacatggtc
tacacctcggctgccgcactcgccgcgtctctcaacgtcgacgagatccacaagggtctc
atctacccccgcatcgagcgtgtccgtgacgccagcgtcatcgttgcccgcgaggtcatg
aagtccgcccgcagagccggcgtctccaagcttcccgagtcccagtgggtcgagtgggag
gagtggggtgacgtcgccttggacgcctggatcaaggagcgcgtctacgaccccgtcagc
ttctccgagaagagccgaatttga

DBGET integrated database retrieval system