KEGG   Colletotrichum fioriniae: CFIO01_08551Help
Entry
CFIO01_08551      CDS       T04796                                 

Definition
(GenBank) SET domain-containing protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CFIO01_08551
Enzymes [BR:cfj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CFIO01_08551
Chromosome and associated proteins [BR:cfj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     CFIO01_08551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET Med26 WW SNN_linker
Motif
Other DBs
NCBI-ProteinID: EXF80374
UniProt: A0A010RQV1
LinkDB All DBs
AA seq 986 aa AA seqDB search
VGGAPRLNHREVARFLDPKPKRDELSGCAPSETAQPSLLEALDDTNRKYRYTSLVSRTRP
TEGSRTCLMEDEALATVKMEEVKIEDGVAPNGINMEQDPSRTSAQKKSNQGSRSASMSPS
EGMVNGEGISTPGGTQRPKLSRKASQKPVKRESPLFHDLPDVTEQSCSTFQVIPDCLYGS
KHMGSTDNDALDCDCRSEWHEGKNLSCGEDSDCINRATKMECLAGGGNCGDGCQNQRFQR
KQFADVSVIKTEKKGFGLRANVDMQANDFIFEYIGEVINEPTFRRRMIQYDDEGIKHFYF
MSLTKHEFVDATKKGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFSSRKIKAGEELVFNY
NVDRYGADPQPCYCGESNCTGFIGGKTQTERATKLPLTTVEALGIDDGDAWDTAVAKKPR
KKKPEEDDEEYVNSVQARSLDDDDARKVMATLMQCKEKWIAVKLLQRIQQCEDERVIHSV
MRMHAYQILKTTLNTFIDDHNVVLQALDILDKFPRLTRNKIEGSKIEATIGVLTQSEHEE
VSAKSKKLLDEWSKLELGYRIGKRKFDPNTSATNSFQERRNMDREEDVTAKSTPDPLQNV
EIPKGPRSNIPQRNTHFFNGPPRQRRHQNFNGHGALPLGWFTATDQRGNTYFYSKSGATT
WQRPTKPADAQKSTPKALQEQQLLKNIIDQVTKEQTPRPSASQTPQRAETPVQENKQEKW
RSLSIDKQMKIYENTLFPHVKYVVDKYRHKLPKDDLKRLGKDVCKKLVSSDYKRNRIQDP
TTPLDQKQARKVKAYVKDFLDKAIVKFRHLEKEKATPEGDMDKSKDSATSTNKEIDSPAD
DVVLSDNEEGGSVGSPERKRKREEEVAELQTLTPSDEPSVKRLREFDADGATPPPPPPPP
PADPAPTATPEEPLSEEQRALKEQEEALMRENEESERLEEEELTKAMDIGSTLNGHPPVN
GGGAVDESAIANTGNEVARQQEVMGH
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
gtcggcggcgctcccaggctcaaccacagggaagtggctaggttcttagaccccaagccc
aagcgcgacgagctgagtggctgcgcaccttcggaaactgctcaaccgtcgctcctcgag
gctttggacgatacgaaccgcaaataccgttacacatccctcgtctcgcgcactcgccct
accgagggttcccgtacttgcttgatggaggatgaagcgctggcgacggtgaagatggag
gaggtaaagattgaggatggtgtcgcgccaaacgggatcaatatggagcaagatccaagc
aggacatcggcgcagaagaagagtaaccaggggtctcgctccgctagcatgtcgcccagt
gagggcatggtcaacggcgaaggcatctcgacgccaggaggcacgcagcgaccgaaactt
tcacgcaaagcatcacagaagcccgtcaagcgcgagtcgcctctattccacgatctgcca
gacgtcacggagcagtcgtgcagtacctttcaggtcatacccgattgtctgtatggatcc
aagcacatgggctcgaccgacaacgatgctctcgactgcgactgccgttccgagtggcat
gaaggaaaaaatttatcgtgcggcgaagactccgactgcatcaacagggcgacgaagatg
gagtgccttgctggcggcggcaactgtggcgatggctgccagaatcagagatttcagagg
aagcagttcgccgatgtttcagtcatcaagacggagaagaagggcttcggacttcgtgcc
aacgtcgatatgcaggctaacgacttcattttcgagtacattggcgaggtcattaacgag
ccaaccttccgacgacggatgatacagtacgatgacgagggcatcaagcatttttacttc
atgtcgctgaccaagcacgaattcgtcgatgcgacaaagaagggcaacctggggcgtttt
tgcaaccactcatgcaacccgaattgctacgtcgacaaatgggtcgtcggagaaaagctg
cgcatgggcattttctcctcacgcaaaatcaaagccggtgaggagttggtgttcaactac
aatgttgaccgctatggagccgacccccaaccctgctactgtggcgagtcgaattgcact
ggattcattggtggcaagacccagaccgagcgggcgaccaagttgccccttactacagtg
gaggcgctcggcattgacgacggtgatgcctgggacacagcggtggccaagaagccgcgc
aaaaagaagccagaggaagacgacgaggagtacgttaacagcgtgcaggctagaagcctc
gacgatgatgatgcgcgcaaggtcatggcgactcttatgcagtgcaaggagaaatggatt
gctgtcaagctgttgcagcgtattcagcagtgtgaggatgagcgggtgatccactccgtc
atgcgcatgcacgcctaccaaattctcaagacaacgctcaacacctttatcgacgaccac
aacgtcgttctccaggctctcgatattctcgataagttcccgcgactgacccgaaacaag
attgagggctccaagattgaagccaccattggtgtacttactcagtctgaacatgaagag
gtcagcgcgaagtcgaagaagttgttagacgaatggtccaaattggagctcggttaccgc
atcgggaagcgaaagtttgaccccaacacatctgccacgaattccttccaagagaggcgc
aacatggaccgcgaagaggatgtgactgcgaaatcgactcctgaccccctccagaatgtc
gaaatccccaaaggacctcgaagcaacattccgcaacgaaacacacatttcttcaatggc
cctccgcgccaacgaagacaccaaaacttcaatggtcatggagcattaccactcggatgg
tttacagcgacggatcagcgcgggaacacgtacttttatagcaagagcggtgctacgacc
tggcaacgtcccaccaagcccgctgacgctcaaaagtcgacacccaaggcgttacaagag
cagcagctgctcaaaaacattatcgaccaagtcacgaaggagcaaactcccaggccttca
gcatcacagacaccgcaacgcgcagagactcccgttcaggagaacaagcaggaaaagtgg
cgatctcttagcatcgacaaacagatgaagatctatgagaatacgctcttcccccacgtc
aagtatgtcgtcgataagtacagacacaagcttcccaaggatgatcttaagcgacttggc
aaggatgtttgcaagaaacttgtgtcatcagactacaagcgcaatcgaatccaagacccc
acgactccacttgaccagaagcaagctagaaaggtcaaggcttatgtgaaggactttttg
gacaaggctattgtgaagttcagacatctcgagaaggagaaggcgactcccgaaggcgac
atggacaagtccaaggactctgccacttcgaccaacaaggagattgattcaccagccgac
gacgttgtgctgtccgacaatgaggaagggggatcagtgggtagtcctgagcgcaagcgc
aagcgtgaggaggaggtagctgagttacaaaccctgactccctcagatgagccatctgtg
aagcgccttagggagtttgatgcggatggtgcaacaccaccgcctcctcccccgccacct
cctgctgatccggcacctactgctacccctgaggagccgctgtcagaagaacaaagggcc
ctgaaggagcaggaggaggctctaatgcgagagaacgaagagtctgaacgtctggaagaa
gaagagcttaccaaagctatggacatcggaagcaccttgaacggtcaccccccggttaat
gggggaggagctgtcgatgagtctgccattgccaacaccgggaatgaagtggctcggcag
caagaggttatgggtcactag

DBGET integrated database retrieval system