KEGG   Colletotrichum fioriniae: CFIO01_08611Help
Entry
CFIO01_08611      CDS       T04796                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00020  Citrate cycle (TCA cycle)
cfj00190  Oxidative phosphorylation
cfj01100  Metabolic pathways
cfj01110  Biosynthesis of secondary metabolites
cfj01130  Biosynthesis of antibiotics
cfj01200  Carbon metabolism
Module
cfj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cfj_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFIO01_08611
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CFIO01_08611
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CFIO01_08611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: EXF79789
UniProt: A0A010RP77
LinkDB All DBs
AA seq 729 aa AA seqDB search
MDFLLPIDKETQFHPHLGNAARERAKSTRSKTCARFAVVYSVLFSIHWLEVYPSPRASTS
FWRPIQFDGLTSPLSLPSSDNVYTSIMASSMALRRFAAKPAFSQARAFSTTRSAARIYAN
QHLRAKEASPYLSSKYPVVDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSH
TVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIVELENYGCP
FSRTEDGKIYQRAFGGQSQKFGKGGQAYRCCAAEDRTGHALLHTLYGQSLRHNTNYFIEF
FALDLIMQDGECRGVVAYNQEDGTLHRFLANHTVLATGGYGRAYFSCTSAHTCTGDGMAM
VARAGLPNQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLAS
RDVVSRSMTMEIREGRGVGEEKDHIFLQLSHLPAEVLHERLPGISETAGIFAGVDVRTQP
IPVLPTVHYNMGGIPTKYTGEVITVDESGNDKVVPGLFACGEAACVSVHGANRLGANSLL
DLVVFGRAVSHTIRDKFTPGTKHKPLAADAGAEAIETLDDVRTREGSRTTSDVRLSMQKA
MQTEVSVFRTQESLDEGVRKMTEIDAQFPDVSIKDKSMIWNSDLVETLELRNLLTCASQT
ATSAAARKESRGAHAREDFPDRDDVNWMKHTLSFQKNPHGKVDLGYRGVIANTLDENECK
AVPPFKRVY
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggactttctcctccccatcgacaaagagacccagttccacccgcacctcggcaatgcc
gctcgggaacgggcaaagagcacccgtagtaagacgtgtgcgaggtttgccgtggtttat
tccgtacttttctccatacactggttggaggtctatccatcacctagagccagcacctcg
ttttggagaccaattcaattcgacggcttgacctctcctctctctcttccgtcttccgat
aacgtgtacacatcaatcatggcctcatcaatggcgttgaggaggtttgctgccaagcct
gctttctcgcaggcgcgcgcattctccacgactagatccgccgcgcggatttacgcgaac
cagcaccttcgcgcaaaggaggcttcaccttacctttccagcaagtaccccgtcgtcgac
catgagtacgatgccatcgttgtcggcgccggtggtgctggtctccgtgccgcctttggt
ctcgcagaggctggcttcaacactgcctgtatctcaaagcttttccctaccagaagtcac
accgtcgccgctcagggtggcatcaacgccgccctcggaaacatgcacgaggacgactgg
agatggcacatgtacgatacagtcaagggttcagattggctcggtgaccaggatgcgatt
cattacatgacccgtgaggcgcccgcctccatcgtggagcttgagaattacggatgcccc
ttctcaagaaccgaggatggcaagatttaccagcgcgctttcggtggtcagtcccagaag
tttggtaagggtggacaggcttacagatgctgcgccgctgaggatcgtaccggccatgct
cttctccacaccctttacggacagtctctccgtcacaacaccaactactttatcgaattc
ttcgctctcgacctgattatgcaggatggcgagtgccgtggtgtcgtcgcctacaatcag
gaggacggcactctgcaccgtttcctcgctaaccacactgtcttggccactggcggatac
ggacgtgcctacttctcttgcacatctgcccacacctgcaccggtgacggtatggccatg
gttgctcgtgctggtctgcctaaccaggatctggagtttgttcagttccaccccactggc
atctacggcgctggctgcttgattacggagggagctcgtggtgagggtggttaccttctg
aactccgagggtgagcgcttcatggagcgttacgcccccaccgccaaggatcttgcgtcc
cgtgacgtcgtctcccgttccatgaccatggagattcgcgagggacgtggtgttggcgag
gagaaggatcacattttcttgcagctcagccatctgcccgccgaggttcttcacgagcgt
ctgcccggtatctccgagactgctggcattttcgctggtgtcgacgttcgcacccagcct
attcccgttctgcccactgttcactacaacatgggtggtattcctaccaagtacaccggt
gaggtcatcactgttgacgagtctggcaacgacaaggtcgttcctggtctgttcgcctgc
ggtgaggccgcctgtgtctccgtccacggtgccaaccgtctgggtgccaactctctcctc
gacttggtcgtcttcggccgtgccgtttctcacaccatccgtgataagttcactcctggt
accaagcacaagcctctggctgctgatgctggtgctgaggccattgagactctggatgac
gttcgcacgcgcgagggtagcagaaccacctccgacgttcgtctgtctatgcagaaggct
atgcagactgaggtcagcgttttcagaacacaggagtctctggatgagggtgtccgcaag
atgaccgagattgacgctcagttccccgatgtttccatcaaggacaagagcatgatctgg
aactctgacttggttgagacccttgagctccgcaacctgttgacctgcgcttcccaaacc
gccacttcagccgccgctcgcaaggagtctcgtggtgcccacgcccgcgaggacttcccc
gaccgtgacgacgtcaactggatgaagcacaccctctccttccaaaagaacccccacggc
aaggtcgacctcggctaccgtggcgtcattgccaacactctggacgagaacgagtgcaag
gctgttcctcccttcaagcgtgtgtactaa

DBGET integrated database retrieval system