KEGG   Colletotrichum fioriniae: CFIO01_08849Help
Entry
CFIO01_08849      CDS       T04796                                 

Definition
(GenBank) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00250  Alanine, aspartate and glutamate metabolism
cfj00410  beta-Alanine metabolism
cfj00430  Taurine and hypotaurine metabolism
cfj00650  Butanoate metabolism
cfj01100  Metabolic pathways
cfj01110  Biosynthesis of secondary metabolites
Module
cfj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CFIO01_08849
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFIO01_08849
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFIO01_08849
   00430 Taurine and hypotaurine metabolism
    CFIO01_08849
Enzymes [BR:cfj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CFIO01_08849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Neuralized
Motif
Other DBs
NCBI-ProteinID: EXF73967
UniProt: A0A010Q2E2
LinkDB All DBs
AA seq 512 aa AA seqDB search
MNGTNGTNGHHAVPQTLKRAEEVEDLLDAIKGLIVPYIRAADEAAGQKANGHTSVDIEGV
PSNVLVDTQKPEALVEKLKLSLPEGDGLGKEGLLDVVQKILRYSVNTWDQGFMDKLYASN
TPVGVVSDLVLSVLNTNLHVYQVSPALSIIEKITARKFANLFGFTGPRAGGVTCQGGSSS
NLTSLVVARSALYPETKASGNGSHDFVIFTSAHGHYSVEKSALACGLGASSVWAVPIDAA
GCMIPEALRELVLRAKAEGKTPLYVNSTAGTTVMGSYDPFEEISSICKEFGLWFHIDASW
GGSAIFSEKQKAKLKGSHLADSLTVNPHKMMNVPVTCSFLLTPDEKVFHKANTLPAGYLF
HNVDEAEDVWDLADLTLQCGRRGDSLKLALAWIYYGAGGFERQIDHAFSLAEHLATLVQK
SDNFVLVSSNPPPCLQVCFYYAPNGQLAEKPEANTRRTSEMVHKLIQRGFMIDYAPGERG
SFFRVVVNCQTLQGTVEGLVKALEEVGKEIAA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcacaaacggcacaaatgggcaccacgcagtcccgcagacgctcaaaagagcc
gaggaagtagaggatctgcttgatgccatcaagggtctgatcgtcccgtacatcagagca
gccgatgaggcggctggccaaaaggccaacggccacacatccgtcgatattgaaggcgtc
ccgagcaatgtcttggtcgacacgcagaagcccgaggcgttggttgaaaagttgaagctg
tctctccccgagggcgatgggctcggcaaggagggcttgctcgatgtcgtgcaaaagatc
ttgaggtacagcgtcaacacttgggatcaaggcttcatggataagttgtacgcaagcaat
actccggtgggcgtcgtctccgatctcgttctatctgtcctgaacacaaatcttcacgtc
taccaagtctcacccgcactgagcataatcgaaaagatcacggcacgaaagtttgcaaac
ctcttcggcttcaccggtccccgcgccggcggcgtcacctgccagggcggtagctcctcc
aacctgacctccctcgtcgtggcgcggagcgccctctacccagagacaaaggcatccggc
aacggctcgcacgatttcgtcatctttaccagcgcccacggtcactactctgtcgaaaag
agcgccctggcctgcggtctcggcgcctcgagcgtgtgggccgtacccatcgacgccgcc
ggatgcatgatccccgaagccctccgcgagctcgtcctccgcgccaaggcggagggcaag
acgcccttgtacgtcaactcgacggccggaacgacggtcatgggctcctacgacccgttt
gaggagatttcgagcatctgtaaggagtttggcttgtggttccacatcgacgccagctgg
ggagggtccgccatcttctcagagaagcaaaaggccaagctcaagggctcccatctggcc
gactcgttgacggtcaacccgcacaagatgatgaacgtacccgtaacgtgctcgttcctg
ctcacgccggacgagaaggtattccacaaggccaacacgttgcctgcggggtacttgttc
cacaacgtggacgaggccgaggacgtgtgggatctggcggaccttaccctccagtgcggt
cgcaggggcgacagtctgaagctggcgttggcttggatctactacggtgccggcggtttc
gaacgacagatcgaccatgccttttccctggcggagcacctcgcgacgctggtgcagaag
agcgacaactttgtcctggtctcgtcgaacccgccgccttgcttgcaggtctgcttctac
tatgcgccaaacggccagcttgcagagaaacccgaggcgaacacgagacggaccagcgaa
atggtacacaagctgatacagcgcgggtttatgattgactatgctcctggggaacgaggt
agcttcttccgggttgtcgtcaactgccagaccctccagggaaccgtcgaaggcttggtc
aaggcgctagaagaagtcggcaaggagattgcggcgtaa

DBGET integrated database retrieval system