KEGG   Colletotrichum fioriniae: CFIO01_08925Help
Entry
CFIO01_08925      CDS       T04796                                 

Definition
(GenBank) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00500  Starch and sucrose metabolism
cfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFIO01_08925
Enzymes [BR:cfj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CFIO01_08925
Glycosyltransferases [BR:cfj01003]
 Polysaccharide
  Storage polysaccharide
   CFIO01_08925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glyco_trans_4_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-ProteinID: EXF77175
UniProt: A0A010QKE8
LinkDB All DBs
AA seq 714 aa AA seqDB search
MSDFPQGQRDNNDRPARDVKNHLLFEIATEVAHRVGGIYSVLKSKAPVTTAEYGDRYTLI
GPLNHNSAAVEVEELEPTNPELAATIQSMRDRGIGILYGRWLIDGAPRVLLFDTKTAYHF
MDEWKADLWNVASIPSPPNDDETNEAVIFGYVVAWFLGEFVCHEKKRAVIAHFHEWLAGV
ALPLTKRRRIDVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIER
AAAHSCDVFTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQAKEKIHD
FVRGHFYGHYDFDPENTLYFFTAGRYEFRNKGVDMFIESLARLNHRLKSAGSKITVVAFV
IMPAQTTSLTVEALKGQAVIKSLRDTVDVIEKGIGRRIFERSLKWHDGDPMPDDKELISA
QDRVLIRRRLFAMKRHGLPPIVTHNMLNDSEDPVLNQIRRVQLFNHPTDRVKIVFHPEFL
NSANPVLPLDYDEFVRGTHMGIFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELI
ENSSDYGIYIVDRRTKGVDDSVNQLTNHMFDFCQKSRRQRINQRNRTERLSDLLDWKRMG
MEYVKARQLALRRAYPGSFNGEEEEDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASL
QEGREGLNTEDYVAWKLPEEEDPDEYPFPLTLRAKRPSGPASPLDGVQLNGNGN
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacttcccccaaggccagcgggacaacaatgaccgcccggctcgcgatgtaaag
aaccacctgctattcgaaatcgcaactgaggttgcccatcgagtcggtggtatctactca
gttctcaagtccaaagctcccgtgaccacggccgagtatggcgatcgctataccctcatc
ggacccttgaaccacaactcggccgcagttgaggtggaagagttggagcccacgaatccc
gagcttgctgctacgatccagtccatgagagaccgtggaattggcatcctctacggacgt
tggctcatcgatggcgctcctcgagtcctgctcttcgacacaaagacagcttaccatttc
atggatgagtggaaggccgacctgtggaacgtcgccagcattccttcgccgcccaacgat
gacgagacaaacgaagctgttatttttggatacgtcgtcgcctggttcttgggagagttt
gtgtgccacgagaagaagagagccgtcattgcgcatttccacgagtggcttgccggtgtc
gctctgccgctcaccaagagacgccgcatcgacgtgacgacaatcttcactacccacgca
accctcttgggaagatacctctgtgctggatccgttgacttttacaacaacctacaatgg
tttgatgttgatgccgaggccggaaagcgtggaatctaccacagatactgcatcgagcgc
gccgccgcccactcctgcgatgtcttcaccactgtctcacacatcaccgcctacgagagc
gagcacttgctcaagaggaaacccgacggcgtgctgcccaacggtctcaacgtgaccaag
ttctccgccatgcacgagttccaaaacctgcatcaacaagccaaggaaaagattcacgac
tttgtccgcggccacttctacggccactacgacttcgaccccgagaacacgttgtacttc
ttcaccgccggccgttacgaattcaggaacaaaggtgtcgatatgttcatcgagtccctc
gcccgcctgaaccaccgcctcaagagcgccggtagcaagattactgtcgttgcctttgtg
atcatgccagctcagaccacttcgctcaccgtcgaggcactcaagggccaggccgtcatc
aagtcgctgcgcgacactgtggatgttatcgaaaagggtatcggtcgtcgcatctttgag
cgctcgctcaagtggcacgacggtgacccgatgcctgatgataaggagctcatcagcgcg
caagatcgtgtactcatccgcaggcggttgttcgcgatgaagcgccacggcctccccccc
atcgttacacacaacatgctcaacgacagcgaggaccccgtactgaaccagatcagacgt
gtccagctcttcaaccaccccacagaccgtgtcaagattgtcttccaccccgaattcttg
aactcggccaaccctgtcctgcctctggactacgacgagttcgtacgcggtacgcacatg
ggtatctttgcttcgtactacgagccttggggatacaccccggccgaatgcacagtcatg
ggtgttcctagcatcacgaccaacctgtccggctttgggtgttacatggaggagttgatt
gagaactcgagcgactacggtatctacattgtggaccgcagaaccaagggtgttgatgac
tcggtcaaccagctcaccaaccacatgtttgacttttgccagaagagccgtcgtcaacgc
atcaaccagcgtaaccgcacggagcgcctgagcgatctgttggactggaagagaatgggc
atggagtacgtcaaggctcgccagttggccctgagacgggcttacccaggctctttcaac
ggagaggaggaggaagacttcatccccggcgtcgagcagaagatttcgcgacccttttcg
gttcctggatctcctcgcgaccgcactggcatgatgacgcctggcgatttcgccagtctg
caagaaggccgggagggtttgaacacggaggactatgtcgcctggaagttgcctgaggag
gaagaccccgatgaatacccattcccgcttactctgcgcgccaagcgcccgtcgggaccg
gctagccctctcgatggagttcagctcaacggcaatggcaactag

DBGET integrated database retrieval system