KEGG   Colletotrichum fioriniae: CFIO01_11310Help
Entry
CFIO01_11310      CDS       T04796                                 

Definition
(GenBank) glycolipid 2-alpha-mannosyltransferase
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CFIO01_11310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cfj01003]
    CFIO01_11310
Enzymes [BR:cfj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     CFIO01_11310
Glycosyltransferases [BR:cfj01003]
 Glycan extension
  Yeast mannan chain
   CFIO01_11310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15 Ribosomal_L32e
Motif
Other DBs
NCBI-ProteinID: EXF80102
UniProt: A0A010QJD5
LinkDB All DBs
AA seq 431 aa AA seqDB search
MATGSARYVRYILFAFFGLAVFYFISHSSYEGVRLQDSSFSKPGGAPAGSQQQQQGENKE
AEKPKQPAQPESKSPKVGEAYNPKDWPMAMTPNEPGWDELSGIASGPRMNATFVTLARNS
DIWDIARSIRQVEDRFNRRYNYDWVFLNDKPFDATFKKVTTSLVSGKTHYGEIPKEHWSF
PEHIDQEKARKVREDMAQRKIIYGDSVSYRHMCRFESGFFFRQPAMMNYDYYWRVEPSIE
LFCDIHYDPFRFMKENNKKYSFVLSLYEYVETIPTLWDSTKKFIKNHPEHIAEGNSMGFL
SDDGGDSYNHCHFWSNFEVGDLNWLRSKAYIDYFESLDQDGGFFYERWGDAPVHSIAAGL
MLPKDQIHFFNDIAYYHVPFTHCPTGEKVRLDRRCHCNPKDNFDWKGYSCTSRYFEINGL
DKPEGYENQQD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaggctcagcacgctatgtgcgatacattctcttcgccttcttcggcctcgcc
gttttctacttcatttcccactcgagctacgagggcgtaaggcttcaggatagctctttc
agcaaacccggcggtgctccggccggcagccagcagcagcagcaaggcgagaacaaggag
gccgagaagcccaagcagcccgctcaacccgaatccaagagccccaaggtcggcgaggca
tacaaccccaaggactggcccatggcgatgaccccgaacgagcccggctgggatgagctc
tctggcattgcatccggcccacgcatgaatgccacctttgtcactctcgcccgcaactcc
gatatctgggacattgcccgctccatccgtcaggttgaggaccgattcaaccgccgctac
aactacgactgggttttcttgaacgacaagcctttcgatgccaccttcaagaaggtcacc
acctcccttgtttccggcaagactcactacggcgaaatccccaaggagcactggtcattc
cctgagcacattgatcaggagaaggcccgcaaggttcgcgaggacatggcccagcgcaag
atcatctacggcgactctgtgagctaccgccacatgtgccgcttcgaatctggtttcttc
ttccgccagccggccatgatgaactacgactactactggcgtgttgagccctccattgag
ctcttctgcgatatccactacgatccgttccgcttcatgaaggagaacaacaagaagtac
agcttcgttctgagcttgtacgagtacgtcgagaccatccccactctctgggacagcacc
aagaagttcatcaagaaccaccccgagcacattgccgagggcaactccatgggcttcctc
agtgacgacggtggtgactcttacaaccactgccatttctggtccaactttgaagttggt
gacctcaactggctccgttcaaaggcctacatcgactacttcgagtccctcgaccaggat
ggtggtttcttctacgagcgttggggtgacgcgcctgtgcactccatcgccgccggtctc
atgctgccaaaggaccagattcacttcttcaacgatatcgcctactaccacgttcccttc
actcactgccccactggcgagaaggttcgtctcgacagacgctgccactgcaaccccaag
gacaacttcgactggaagggctactcttgcacgagccgctacttcgagatcaacggtttg
gacaagcccgagggttacgagaaccagcaggactag

DBGET integrated database retrieval system