KEGG   Colletotrichum fioriniae: CFIO01_12107Help
Entry
CFIO01_12107      CDS       T04796                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00020  Citrate cycle (TCA cycle)
cfj00480  Glutathione metabolism
cfj01100  Metabolic pathways
cfj01110  Biosynthesis of secondary metabolites
cfj01130  Biosynthesis of antibiotics
cfj01200  Carbon metabolism
cfj01210  2-Oxocarboxylic acid metabolism
cfj01230  Biosynthesis of amino acids
cfj04146  Peroxisome
Module
cfj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfj_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFIO01_12107
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CFIO01_12107
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CFIO01_12107
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CFIO01_12107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: EXF80957
UniProt: A0A010QLN7
LinkDB All DBs
AA seq 452 aa AA seqDB search
MNAARFLRRPATFALRPSFIVPQSSASFSSSASFNFARTMAAAAKIKVKNPVVELDGDEM
TRIIWQTIKDKFIHPYLDIDLKYYDLGLPYRDETNDKVTLDAAEAIKKYSVGVKCATITP
DEQRVEEFKLKQMWLSPNGTIRNHLGGTVFREPIVIPRVPRLVPGWKKPIIIGRHAFGDQ
YRAKDAVLPGNGTLKMVYTPEGGEPQEIEVYKFKNGGGVAQTQYNTDESITGFAHASFKL
ALTKKLPLYMSTKNTILKKYDGRFKDIFQELYETKYKAEFEAAGIWYEHRLIDDMVAQMV
KSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHYREH
QKGNETSTNPIASIFAWTRGLIQRGKLDETPEVVAFAESLEKACIDTVDVDGIMTKDLAL
ACGKTARSDYVTTNEYLNAVERRMKNILKEKL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagcccgcttcctccgccgtcccgcaacctttgcactccggccctccttcatc
gttccccagtcttccgcctccttctcctcctccgcctccttcaactttgcccgcacaatg
gccgccgccgccaagatcaaggtcaagaaccccgtcgtcgagctcgatggcgacgagatg
acccgtatcatctggcagaccatcaaggacaagtttatccacccctacctcgacatcgac
cttaagtactacgatctcggcctgccctaccgtgacgagaccaacgacaaggtcaccctc
gacgccgccgaggccatcaagaagtactcggtcggtgtcaagtgcgccaccatcactccc
gatgaacagcgtgtggaggagttcaagcttaagcagatgtggctctcccccaacggcacc
atccgtaaccacctcggcggtaccgtattccgcgagcccatcgtcatcccccgcgttccc
cgcctggtgcccggctggaagaagcccatcatcatcggccgtcatgccttcggcgaccag
taccgcgccaaggatgccgttctccccggcaacggcacccttaagatggtctacaccccc
gagggcggcgagccccaggagattgaggtctacaagttcaagaacggcggcggtgtcgct
cagacccagtacaacactgacgagtccatcaccggcttcgcccacgcttccttcaagctc
gccctcaccaagaagctacccctgtacatgagcactaagaacaccattctcaagaagtac
gacggccgcttcaaggacatcttccaggagctctacgagaccaagtacaaggccgagttc
gaggccgctggcatctggtacgagcaccgtctcattgacgacatggttgcccagatggtc
aagtcctccggtggctacatcatggccctcaagaactacgacggtgacgtccaatccgac
attgtcgcccagggcttcggctccctcggtctcatgacttcggtcctcatcacccccgac
ggcaagaccttcgagtccgaggccgcccacggcaccgtcacccgccactaccgcgaacac
cagaagggtaacgagacctccaccaaccccattgcctccatcttcgcctggacccgcggt
ctcatccagcgcggcaagctcgacgaaacccccgaggtcgtcgcctttgctgagtccctc
gagaaggcctgcatcgacaccgtcgacgttgacggcatcatgaccaaggacctggctctc
gcctgcggcaagaccgcccgctctgactacgtcaccaccaacgagtacctcaacgccgtc
gagcgccgcatgaagaacatcctcaaggagaagttgtaa

DBGET integrated database retrieval system