KEGG   Colletotrichum fioriniae: CFIO01_12493Help
Entry
CFIO01_12493      CDS       T04796                                 

Definition
(GenBank) oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00020  Citrate cycle (TCA cycle)
cfj00310  Lysine degradation
cfj00380  Tryptophan metabolism
cfj01100  Metabolic pathways
cfj01110  Biosynthesis of secondary metabolites
cfj01130  Biosynthesis of antibiotics
cfj01200  Carbon metabolism
Module
cfj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFIO01_12493
  Amino acid metabolism
   00310 Lysine degradation
    CFIO01_12493
   00380 Tryptophan metabolism
    CFIO01_12493
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CFIO01_12493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N YceG_bac BioY
Motif
Other DBs
NCBI-ProteinID: EXF85238
UniProt: A0A010SK34
LinkDB All DBs
AA seq 1043 aa AA seqDB search
MLRSSVYRAGTRVLHTSKPTSSSSCFSTIASRTSTRKLAAARRPLALTSQRHYASATDNA
PNPNDNFLSGNTANYIDEMYMQWKQDPKSVHVSWQVYFKNMENGDMPIAQAFTPPPSLVP
GAIGGVPALGAGLGQGSEITNHLKVQLLVRAYQARGHHKANIDPLGIRNESQGFGNIKPK
ELTLEHYQFSEKDLDAEYELGPGILPRFKKDGREKMTLREIIDACEKIYCGAYGIEFIHI
PDREKCDWLRERIEVPRPFKYSIDEKRRILDRLIWSSSFESFLATKYPNDKRFGLEGCET
LVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTAGAEDEGSG
DVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEKTHRTAMG
VLLHGDAAFAAQGVVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARSTAYCTDIA
KAIDAPVFHVNADDVEAVNFVCQMAADWRAEFQQDVIVDLVCYRKHGHNETDQPSFTQPL
MYKRIQDHESQIAIYVNKLLEDGSFTKEDIEEHKQWVWGMLEESFSKSKDYQPTSKEWTT
SAWNGFKSPKELATEVLPHNETSVDSKTLNHLGEVIGSTPEGFQPHRNLKRILSNRTKSV
VEGKNIDFPTAEALAFGSLVTEGHHVRVSGQDVERGTFSQRHAVFHDQETEDTHTPLQHV
SKDQGKFVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQFIASGE
AKWMQRTGLVVSLPHGYDGQGPEHSSGRLERWLQLSNEDPRVFPSPEKLDRQHQDCNMQV
AYMTSPSNLFHILRRQMHRQFRKPLIIFFSKALLRHPLARSNIEEFSGDSHFRWIIPDPE
HETGVIKPKEEIERVILCSGQVWATLSKYRADNKIDNVAFTRIEQLNPFPWQQLKENLDQ
YPNAKTIVYCQEEPLNAGAWSFVQPRLETLLNNTEHHDRKHVMYAGRGPSASVAAGNKGL
HNKEEQEFLEMAFSVKQDKLKGE
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaagctctgtgtatagagccggcactcgggtgcttcacacctcaaaacctaca
agctcatcatcatgcttctctaccatcgcgtcgcgaacctcaacgaggaagctcgctgct
gcccgtcgccccctggccttaaccagccaacgtcactacgcgagcgcgaccgacaatgca
cccaaccccaacgataacttcctatccggcaacactgccaactacattgacgagatgtac
atgcagtggaagcaagatcccaagagcgttcacgtctcatggcaggtctacttcaagaac
atggagaacggcgacatgcccatcgcccaggctttcactcctcccccttctctggttcct
ggtgccattggcggcgttccagcactcggcgctggcctcggtcagggctctgagatcaca
aaccatctcaaggtccagcttttggttcgcgcctaccaagctcgaggccatcacaaggct
aacatcgatccccttgggattcgaaacgagtctcagggcttcggtaacatcaagcctaag
gaactgactcttgagcactaccaattttctgagaaagatcttgacgccgagtatgagctt
gggcctggcatcttgccgcgcttcaagaaggatggccgcgagaagatgactctccgcgaa
atcattgatgcttgcgagaagatttattgcggcgcctacggcatcgagttcatccacatt
cccgatagagaaaagtgcgactggctgcgtgagcgaatcgaggtcccccgacctttcaag
tactccatcgacgaaaagcgccgcatcctcgatcgtctcatttggagttccagcttcgaa
tccttccttgccacaaaatacccgaacgacaagcgtttcggcctcgagggttgcgagact
ctcgtccccggtatgaaggcgctgatcgatcgcagcgttgactacggcgtcaaggacatc
gtcatcggcatgcctcaccgtggtcgtttaaacgttctaagcaacgtcgtaagaaagccc
aacgagtcaatcttcagcgagttcgccggaactgccggcgctgaggacgaaggctccggt
gacgtcaagtaccatcttggtatgaacttcgagcgccctacaccctccggcaagcgcgtc
cagctttctctcgtcgccaacccctctcacttggaggccgaagaccccgttgtgctcggc
aagacccgcgctatccaacattacaacaatgatgagaagacgcatcgtacagccatgggc
gttctgctccacggtgatgctgccttcgctgcccaaggtgttgtctacgaatgtcttggt
ttccactctcttcctgccttctctactggcggtaccattcaccttgtcgtcaacaaccaa
attggcttcaccaccgatccccgatttgcccgctccacagcttactgcaccgacatcgcc
aaggccatcgacgcacccgtcttccacgtcaacgccgatgacgttgaggctgtcaacttt
gtgtgccagatggctgccgactggcgcgctgagttccagcaagatgtaattgtcgacctt
gtttgctaccgaaagcacggtcacaacgagaccgaccagccctctttcacccagcctctc
atgtacaagcgcatccaggaccatgagtcccagattgccatttacgtcaacaagcttctc
gaggacggcagcttcaccaaggaagatattgaggagcacaagcagtgggtctggggtatg
ctggaggagagtttctccaagtccaaggactaccaacccacctccaaggaatggaccacc
tccgcgtggaacggtttcaagtctcccaaggagcttgcgactgaggtccttcctcacaac
gagacaagcgtggacagcaagactctaaatcaccttggcgaggtcattggcagcaccccc
gagggcttccagcctcatcgcaacctcaagcgtattctgtctaacaggaccaagtctgtc
gtcgagggcaagaacatcgacttccccactgcggaagcccttgcctttggttccctcgtc
actgagggccaccacgttcgtgtttctggtcaggatgttgagcgtggaactttctctcag
cgccatgctgtcttccacgaccaggagaccgaagacacccacactcctctacagcacgtc
agcaaggaccagggcaagttcgtcatctccaactcatcgttgagcgagttcggcgctctc
ggtttcgagtacggctactctctgtcttctcccaatgctctcgtcatgtgggaggcccag
ttcggtgatttcgccaacaatgcgcagtgcatcatcgatcagttcatcgcttcgggtgag
gccaagtggatgcaaagaactggtcttgtggtatctctgccccacggatacgacggccag
ggtccagagcattcttctggtcgtctcgagagatggctacagctgagcaacgaggaccct
cgcgtcttcccctcccctgagaagttggaccgccagcaccaagactgcaacatgcaggtc
gcatacatgactagcccctccaacctgttccacatcctccgcagacagatgcatcgtcaa
ttccgcaagcctctcatcattttcttctccaaggctctgctccgccacccattggctcgc
tccaacattgaagagttctctggtgactctcacttccgctggatcatccccgacccggag
catgagactggcgtcatcaaacctaaggaggagattgagcgcgtgattctctgctctggc
caggtttgggctactctatccaagtaccgcgccgataacaagatcgacaacgttgcgttc
acccgcatcgagcagctgaaccccttcccctggcaacaactgaaggagaacctcgaccag
taccccaacgccaaaactatcgtctactgccaagaggagcccctgaacgctggtgcttgg
agtttcgtccagcctcgcctggagactctgctcaacaacaccgagcaccatgatcgcaag
catgtcatgtacgctggccgtggccctagtgcatctgtcgccgctggtaacaagggtctg
cacaacaaggaggagcaagagttcctggagatggctttctccgttaagcaggacaagctg
aagggcgagtaa

DBGET integrated database retrieval system