KEGG   Colletotrichum fioriniae: CFIO01_12568Help
Entry
CFIO01_12568      CDS       T04796                                 

Definition
(GenBank) histone deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cfj  Colletotrichum fioriniae
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfj03036]
    CFIO01_12568
Enzymes [BR:cfj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CFIO01_12568
Chromosome and associated proteins [BR:cfj03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CFIO01_12568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C Adaptin_binding Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: EXF73430
UniProt: A0A010Q9T4
LinkDB All DBs
AA seq 1192 aa AA seqDB search
MASPFDRAPSRRPSLLNTSSHDGDKDLAHSLKQLSLSTSSASNSPRASSALSPMRPAVNR
TSPAPSPRAPSRSPSFARELSRSRSSTPTLQRSSTPTLQRKTSTSSLHSVSGSSSRTPSR
APSRRTSMVHASSPVAKSPLRPSPPEYIKPAPTANTVARDYFKTELEVHHSPTSTRATET
LVILHDACYGHRFSRPKTSKGALSTIVERPERIKAGVLGVAMAYVRLGERHCDGAYALHP
SLDPSTIPTIPFRIYKTERRLPLTSAAVTNVHGTKWMEELKMMCEGAEIKLATGGKELQR
PELNRGSDGPPAKFHEGDLYLCSESLEAFEGALGAVCEAVDRVFTSGPRRAFVAVRPPGH
HCSASFPSGFCWVNNVHVGIMHGILNHGLTHAAIIDFDLHHGDGSQAITWAHNSRGVNAA
KNTTAWKKASIGYFSLHDINSYPCEWGDEEKVKNASLCIDNAHGQNIYNVHLESYGSEKE
FWELYETRYSIILEKTRKYLKNQAARLRALNMPPRAAIFFSAGFDASEWETKGMQRHNVN
VPTEFYARIAQDVVKLAAEEGLGVDGRVISVLEGGYSDRALYSGIFSHLSGLSGNQTPEE
PTRGRSSLGDEMAGQIAATITGEPSLHPYKPSWWSSSELDELEVAMGNRPASPKMIRHST
PPTYSTPTQASIGKSIDPARMRRMASGLSNGMPYSRPATPPPPDVPWTIAAHELSRLLIP
SDRQVDSCKPEDLNAEATRARRDRQSILNPDLVPPAPAPAPAPKPASRPTSRMSLRERKP
AKPGLYVDVDEDDDKQSKNRRRTVAGPAALSSEKATARGIPSDRNGAAKRPGRRLSGVSI
VTSNAPNTEPEGYGVSAQRPDTSMSVRPDTAMSVRTQSATSLNVKKTRAPAVKKEAPKTT
RIVKKPAATAKPSPPQQAGPSQLHQGNPSPAAASEDDMDKLTAGMKKVKVNLITKTQKEE
RAKAAQAAQAAQAAQAKAATPPTTEEAKMGFPFEAQKASSPVAPPIITPPQDEAFATPPT
QPPAVKDPSPPAVPEGRPEVSTPVTELMPPAATPDPRSVELPASSPAAMSPTVATPSSDV
FINYQPEGPPPVSVTPSEPLKWMPPNTNTPVKASPSKPSPAKLSSAKASPMKKSPVKMMR
ADLPVFTSTSAIPFAPPAMSAPSEVKQEPAVKADPEEPAKSVWDIPETPQRQ
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atggcctctccattcgacagagcgccatcgcggcgcccatcactgctcaacacatcctct
catgatggggacaaggacctggcgcattccctcaagcagctatccctttcgacatcatcc
gccagtaactcaccccgggcttcgagcgccctgtctcctatgagaccggccgtaaatcga
acatctccggcaccgagtcctcgagccccgtctcgaagtccctcctttgcgagggagctc
tcccgctcccgatcttcgacgccgacgctgcagcgatcttcaacgccaacacttcagcgc
aagacctccacgagttcactacactctgtgagtggctcttcaagccgaacccctagccga
gcgccttcgaggcgaactagcatggtgcatgcctcttctcccgtcgccaaatcccctttg
cgaccgagcccccctgagtacatcaagcctgcgcccacagcgaatacggttgcccgcgat
tacttcaagaccgaactagaagttcaccactcgccaacttcgactagagctactgagacc
cttgttatcctccacgatgcctgctacggacaccgtttctcccgacccaagacgtctaaa
ggtgccctcagcaccatcgttgagcgccctgagagaatcaaggccggcgttttgggagtc
gccatggcctacgtgcgactcggtgaacggcactgcgatggcgcatatgcgctgcatcca
agcctggatccctccactatcccgacgattccgtttcgcatctacaagaccgagcgaaga
ttgcccctgacatcggcggctgtcacaaatgtccacggcaccaagtggatggaggagctc
aagatgatgtgcgaaggagcagagataaagttagcgactggtgggaaggaacttcaaagg
ccagaattaaacaggggttcagacggaccgcctgcgaaattccacgagggtgacctctat
ctttgctccgaatcgctcgaggcctttgagggtgctttgggtgccgtctgcgaagccgta
gaccgagttttcacatccggccctcggcgagcctttgtcgctgtacgcccaccgggacat
cactgctcagcttctttcccgtcagggttttgctgggttaataacgtccacgtcggaatt
atgcatggcattttgaaccatggtcttacccacgcggccatcatcgatttcgatcttcac
cacggagatggctctcaagctattacttgggcgcataactcgcgaggagtgaatgcggcc
aagaacacgacagcttggaagaaggcgtccatcggctacttcagtcttcacgatatcaac
tcgtacccctgtgagtggggtgatgaggagaaggtcaagaacgccagtttgtgtattgac
aatgctcatggccaaaacatctacaacgtccacctggaatcgtatggttcagagaaggag
ttctgggagctgtacgagaccagatactcaattattctggagaagacgcgcaaatatctg
aaaaaccaagcagctcggcttcgcgctctgaatatgcctccgagggcggcgatcttcttc
tcggcgggatttgatgccagtgagtgggagaccaagggtatgcaacgtcataatgtgaac
gttcctaccgagttttacgcccgtattgctcaagatgtcgtgaagcttgccgcggaggaa
ggcttgggagttgatgggcgggttatcagtgtgcttgagggtggctacagtgaccgagct
ctttactctggcattttcagccatctgagcggactttcaggaaaccagaccccggaagag
cccactcggggtcgctcttcgctcggcgacgaaatggcagggcagattgctgcaaccatt
actggcgaaccatctctacatccttacaaaccgtcatggtggtcaagctccgaacttgac
gagctagaagtcgcgatgggcaacagaccagccagccccaagatgatccggcactcaact
ccgccgacgtactcaactcccacacaggcgtcgattggtaagtccatagatccggcgagg
atgagacggatggcgtccggcttgtcgaatggaatgccatattcgagaccagcaacacca
ccgccccctgacgtgccatggaccatagcagcccatgagctgagcaggctactcatcccg
tcagatcgccaagtcgatagctgcaagcctgaagacctgaatgcagaggcgacaagggct
cggagagaccggcagtcgattctaaaccctgatcttgtgccgccggcacctgctcccgcg
cccgcgccgaagccagcaagcaggcccacttcgcggatgtctttaagagagcggaagcca
gcgaagcctggcttgtatgttgacgtagacgaagatgatgacaagcagtccaagaaccgg
cggagaacggttgcgggccctgctgcgctatcatccgagaaggcaacggcccgaggcata
ccctctgacagaaatggagcagctaagcgacccggtcgacgccttagtggtgtgtctatt
gtgacttcgaatgctcccaatacagagcccgagggctacggagtttcagcccagcgtccc
gacacttctatgagcgtgcgaccagacacggcgatgagcgtcagaactcagagtgctacg
tctttgaatgttaaaaagacaagggctccagcagtcaagaaagaagcccccaaaaccaca
agaattgtgaagaagcctgccgcaacggcgaaaccctcccctcctcagcaggctgggcca
tcgcagctacatcaaggaaatccgagcccagctgctgcatcggaggacgatatggacaag
ttgactgccggtatgaagaaggtcaaggtcaacttgatcacgaaaacacagaaagaagag
cgtgccaaggcagcccaagcagcccaagcagctcaagcagctcaagccaaagctgccaca
ccccccacaaccgaagaagcaaagatgggtttcccgtttgaagctcagaaggcttcgtcg
ccggtggcacctccgatcatcacacctccgcaagacgaggctttcgctacaccgccgacg
cagcccccggccgtcaaagatccgtcaccgcctgctgtcccggaaggccggcctgaagtc
tcaactccagtgaccgagctgatgcctcccgccgccacccctgatccccgttcagtagaa
ctccctgcaagctcacccgctgctatgtcgccgaccgttgcgacaccctcatcggacgtc
ttcatcaactatcaaccggagggccctccccctgtgtccgtgacgccgtcagaaccccta
aagtggatgccgcccaacactaatacacccgtcaaagcctcgccgtctaagccatcaccg
gcaaagctgtcatcagctaaagcgtcaccaatgaagaagtccccggtaaagatgatgcgt
gcagatctcccagtcttcacctccacgtctgccatcccatttgcgccgccggcgatgagc
gctccgtctgaggtcaagcaagaaccggcagtcaaggccgatccggaggagccggcaaag
tcggtctgggatatcccggaaactccgcagaggcaatag

DBGET integrated database retrieval system