KEGG   Colletotrichum fioriniae: CFIO01_13099Help
Entry
CFIO01_13099      CDS       T04796                                 

Definition
(GenBank) glycosyl hydrolase family 31
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00052  Galactose metabolism
cfj00500  Starch and sucrose metabolism
cfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CFIO01_13099
   00500 Starch and sucrose metabolism
    CFIO01_13099
Enzymes [BR:cfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CFIO01_13099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-ProteinID: EXF85523
UniProt: A0A010SKX4
LinkDB All DBs
AA seq 921 aa AA seqDB search
MARKLSVFGLLSAVASAAVIRRDYPSDDALSACPGYKASNVQLSSTGLTADLSLAGEACN
AYGTDLTDLTLTVEYQTDTRLHVKIQDAANQVYQIPDSVFPRPEATSLTIAESKLQFNYT
ENPFSFGVSRSDTGEILFDTSGANIVFESQYLRLRTKLPENPNLYGLGEHSDPFRLNTTD
YIRTLWSQDSYGIPSGANLYGNHPVYYEHRKNGTHGVFFLNSNGMDVFINKTEESGQYLQ
YNTLGGVLDFYFVSGPSPIEVAQQYAQITGLPAMMPYWGLGFHQCRYGYRDVFDVAEVVY
NYSIAEIPLETMWTDIDYMDRRRVFSLDPERYPLAKVRQLVDKLHENDQHYIVMVDPAVA
YVESPTLQRGIDDNIWLLRSNGSVWIGVVWPGVTVFPDFFAENITSFWNNEFAQFFSADK
GVDIDALWIDMNEPSNFPCYFPCDDPYGSAVGFPPEPPAVRENPRPLPGWPCDFQPPGTD
CGNNQTKRSDVLVRKQMSPRMIPAGKTFDNLMLAERQSSGDQKGLPDRDLLFPKYAIHNK
AAWDTESNAARGGISNKTVNTDVIHQNGLAMYDTHNLYGSMMSSASRVAMEARRPGLRPL
IITRSTFAGVGKHVGHWLGDNLSNWQQYRVSISQLMQFAAVYQVPMVGSDACGFGDNTNE
QLCARWAALAAFSSFYRNHNSIDSISQEFYRWDTVADSARKAIAIRYRLLDYIYTALYQQ
TKDGTPLINPLFYLYPKDEKTFGLDLQYFYGDTILVAPVTEENSTSVDVYLPDDVFYDWY
THEAIQGTGATVSLTDKDYTTIPLFIRGGSVLPLRANSTMTTKQLREENFELLIAAGRDG
TAKGQLYLDDGVSEEQAGITLVTFDYKDGKVSVDGEFGYSTPLKVSKVTLLSGGTTAKRQ
ETVKTVAVEYALTGPFVIELN
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaaagctttctgtgttcggactactcagcgcagtagcttccgctgctgtgatc
cgcagagactatcctagcgacgacgcactctcggcatgcccgggctacaaggcttccaac
gtccagctgtcctcgactggattgacagcggacttgtcgttggccggagaagcatgcaat
gcatacggaaccgacctgacagacttgactctgactgtcgagtatcagactgatacccgt
ctccacgtcaagatccaagatgccgcaaaccaggtgtaccagatccccgactctgtgttt
ccccggcccgaggccactagcttgaccatcgcagagtctaagctgcaattcaactacacc
gagaatcccttttccttcggcgtgagccgttccgacacaggcgagattctcttcgacact
tctggagccaatatcgtctttgaaagccaatatctccgcctccggaccaagctgcccgag
aaccccaacctgtacggtctcggcgagcattcggaccccttccgactgaacacgactgac
tacatccgcacgttgtggtctcaggattcgtacggtattccctctggtgccaacttgtat
ggcaatcaccccgtctactacgagcaccgcaagaatggcacacacggagtctttttcttg
aactccaacggcatggacgtcttcatcaataagaccgaggaatctggacagtatctccag
tacaacaccctcggcggagtcctcgacttctactttgtttcgggaccttcccccatcgag
gtggctcagcaatacgcccaaattaccggcctaccagccatgatgccatactggggtctc
ggtttccaccaatgccgttacggataccgcgacgtctttgacgttgctgaagttgtctac
aactacagcatcgccgagattcccctcgagaccatgtggactgacattgattacatggac
aggcgaagggtgttctctcttgatcccgagcgttaccccttagccaaggttcgccagctt
gtcgacaagcttcacgaaaatgatcagcattatatcgtcatggtagaccctgcagtggcc
tacgtcgaatcacccaccctgcaacgcggcattgacgacaacatctggcttctccgtagc
aacggttccgtctggatcggtgtcgtctggcctggtgttactgtattccctgatttcttc
gcagagaacatcacttccttctggaacaacgagtttgctcaattcttttcggccgacaag
ggagtcgacattgatgccctctggatcgacatgaacgagccgtcaaacttcccctgctac
ttcccctgcgacgacccttacggttccgccgttggattccctcccgagccaccagccgtc
cgcgagaaccccagacctctacctggctggccttgcgatttccaacctcctggaaccgac
tgcggtaacaaccagaccaagcgatccgatgttctcgtccggaagcagatgtcgcctagg
atgatacccgccgggaagacgtttgacaacttgatgctcgctgagagacaatcatccggt
gatcagaagggcctgcccgaccgtgatcttctcttccccaagtacgccatccacaacaag
gccgcttgggacaccgagtcaaacgcagcccgtggtggtatctccaacaagaccgtaaac
acggatgtgatccaccagaacggtctcgccatgtacgatacccataatctttacggctcc
atgatgtcatccgcctcccgagttgccatggaggcccgccgcccaggtcttcgccccctc
attatcacgcgctccacattcgccggcgtcggaaagcacgtaggccactggctcggcgac
aacctttccaactggcaacagtatcgcgtctccatctcccagctcatgcagtttgctgcc
gtctaccaggttcccatggtcggctccgatgcttgcggcttcggcgacaacaccaacgag
cagctctgcgcgcgctgggccgccctcgccgccttctcttcattctatcgtaaccataac
tccatcgacagcatctcgcaggagttttaccgctgggacacggtggctgacagcgctcgc
aaggccatcgccatccgctaccgcctgcttgactacatctacactgcgctgtaccagcaa
accaaggatggaactccgctcatcaacccgctcttctacctctacccgaaggacgagaaa
acgttcggtctggacctccaatacttctacggcgacaccattcttgtcgcgcccgtgacg
gaagaaaactcgacttcagttgatgtctatctccccgacgacgtcttctacgactggtac
acccatgaggctatccaaggcaccggtgccacggtttccctgacagacaaggactacacg
acgatcccgctcttcatccgcggcggcagcgtgttgcctctacgcgcgaacagcaccatg
acgacgaagcagctgcgcgaggagaactttgagctcttgatcgcggctggcagggatggc
actgcaaagggccagctctaccttgacgatggtgtcagtgaggaacaggcgggtatcacg
ctcgtcacatttgattacaaggacggaaaagtttccgtggatggtgaattcgggtactcg
acgccgctcaaggtgtccaaggttactcttctcagtgggggcacgacggcgaagagacag
gagaccgttaagacggttgctgtcgagtatgccttgactggacctttcgtgatcgagctc
aactaa

DBGET integrated database retrieval system