KEGG   Colletotrichum fioriniae: CFIO01_13484Help
Entry
CFIO01_13484      CDS       T04796                                 

Definition
(GenBank) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00010  Glycolysis / Gluconeogenesis
cfj00051  Fructose and mannose metabolism
cfj00052  Galactose metabolism
cfj00500  Starch and sucrose metabolism
cfj00520  Amino sugar and nucleotide sugar metabolism
cfj01100  Metabolic pathways
cfj01110  Biosynthesis of secondary metabolites
cfj01130  Biosynthesis of antibiotics
cfj01200  Carbon metabolism
Module
cfj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cfj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFIO01_13484
   00051 Fructose and mannose metabolism
    CFIO01_13484
   00052 Galactose metabolism
    CFIO01_13484
   00500 Starch and sucrose metabolism
    CFIO01_13484
   00520 Amino sugar and nucleotide sugar metabolism
    CFIO01_13484
Enzymes [BR:cfj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CFIO01_13484
Membrane trafficking [BR:cfj04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CFIO01_13484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 TPP_enzyme_N FGGY_N
Motif
Other DBs
NCBI-ProteinID: EXF82676
UniProt: A0A010RQD7
LinkDB All DBs
AA seq 526 aa AA seqDB search
MVDRAIAPATRERSYHHTDIFVPSRQSKNTHLQIQYDPCWLTMCENLGSMADVPKDLLAE
VKKLEEQFTVPTEKLKQISAHFITELDKGLSVEGGSIPMNPTWVMSFPDGYETGTYLALD
MGGTNLRVCEITLTDQKSEFDIIQSKYRMPEELKTGQSEELWEYIADCLAQFIQTHHPDH
PQSQKIPLGFTFSYPATQNYIDEGILQRWTKGFDIAGVEGHNVVPFLEAALAAKNVPIKL
SALINDTTGTLIASAYTDTKMKIGCIFGTGCNAAYMEDCGSIPKLAHMNLPPNTPMAINC
EWGAFDNEHKVLPRTPYDIIIDKDSPRPGQQAFEKMIAGLYLGEIFRLVLVDLHDNKSVH
IFENQDIAKLRKAYTLDSSFLSAIEDDPFENLQETSDLFLSKLNLKATRPELELVRRLAE
LIGTRAARLSACGVAAICMKKGYDNCHVGADGSVFNKYPHFKARGAQALREILDWPAKTN
PKEEDPVEILAAEDGSGVGAALIAALTLKRVQNGNMAGILHPENFT
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggtggacagagcgattgctcccgctacaagggagagatcctaccaccacaccgatatc
tttgtcccgtcacgtcaaagcaagaatacacatctacagattcaatacgatccatgttgg
ctaaccatgtgcgaaaatctaggttccatggccgatgtgcctaaggatcttctggctgag
gtcaagaagctcgaggagcagttcaccgtacccactgagaagctcaagcagatcagcgcg
cacttcatcacagagctggacaagggtctgagtgtcgagggtggtagtatccccatgaac
ccgacctgggttatgtccttccccgatggctacgagaccggcacttaccttgccctcgac
atgggcggaaccaacctccgtgtctgtgagatcaccttgacggatcagaagtccgagttc
gacatcattcagtcaaagtaccgcatgcccgaggagctcaagaccggccagtcagaggag
ctgtgggagtacattgccgactgcctggctcagttcatccagactcaccaccccgaccac
cctcagtctcagaagattcctcttggtttcaccttctcttaccctgccacccagaactac
attgatgagggcatcctccagcgctggaccaagggtttcgatattgccggagttgagggt
cacaatgttgtccccttccttgaggctgccttggcggccaagaacgtccctatcaagctt
tctgctctgatcaacgatactactggcaccctgattgcctctgcctacaccgacactaag
atgaagattggctgtatctttggcactggctgcaacgctgcttacatggaggactgcggc
tccatccccaagcttgctcacatgaacttgcctcccaacacccccatggccatcaactgc
gagtggggtgctttcgacaacgagcacaaggtcttgcctcgtaccccctacgacatcatc
attgacaaggactctcctcgtcccggccagcaggcctttgagaagatgattgccggtctc
tacttgggcgagatcttccgcctggtccttgttgacctccacgacaacaagtctgtgcac
atctttgagaaccaggacattgccaagctccgtaaggcttacaccttggattcctccttc
ctgtccgccattgaggacgaccccttcgagaacctgcaggagactagcgacctcttcctc
tccaagctgaacctcaaggccaccagacccgagttggagctggtccgccgccttgctgag
ctcattggcacccgcgccgcccgcctctcggcttgcggtgttgctgccatctgcatgaag
aagggttacgacaactgccacgtcggtgctgacggttcggtctttaacaagtacccccac
ttcaaggcccgtggcgcccaggctttgcgcgagattctcgactggcctgctaagaccaac
cctaaggaggaggaccccgttgagattctcgcagcagaggacggcagtggtgttggcgca
gccctgattgccgccctgacccttaagagagtccagaacggcaacatggctggtattctc
caccccgagaacttcacatag

DBGET integrated database retrieval system