KEGG   Corynebacterium frankenforstense: CFRA_05490Help
Entry
CFRA_05490        CDS       T04872                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cfk  Corynebacterium frankenforstense
Pathway
cfk00620  Pyruvate metabolism
cfk00680  Methane metabolism
cfk01100  Metabolic pathways
cfk01120  Microbial metabolism in diverse environments
cfk01200  Carbon metabolism
Module
cfk_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cfk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFRA_05490
  Energy metabolism
   00680 Methane metabolism
    CFRA_05490
Enzymes [BR:cfk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CFRA_05490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: APT88785
UniProt: A0A1L7CSE4
LinkDB All DBs
Position
1240048..1242816
Genome map
AA seq 922 aa AA seqDB search
MVDDQTNMQDDIRFLGRVLGEVIAEQEGQETFDLVENSRRRAFEVARGEADMSDLAAMFH
DIEAEKARDVIRAFSHFALMANLAEDLYDESARLHRRQAGEPAPASTLDATWRKLAEAGV
DPATISREFPATQVAPVLTAHPTETRRRTVFDAQKHISELMRRRRVLLTAGENALTAGEL
EEIERDVRRRLTILWQTALIRVARPRLEDEVEVGLRYYKLSLLQAIPKLNHDVVKLLSDS
AGAPVPQHPIVQPGCWIGADHDGNPYVTGTTLDYAATRAAETVLKYYAGQLHDLEHELSL
SDRLGEVSEKLYALADEGHNDVPSRVDEPYRRAVHGVRGRILATTVGLIGPDAVEGDWFK
AHEPYADAEEFLADLDLIDSCLRAEHDEIIADARLADLRAAVRTFGFHLYALDIRQNSES
YEDVLTELFSLAHVAEDYRGLDEDAKIKLLVDELRTPRPLVPAGYHDFTEPTERELGIFR
AAAEAVDKFGPEMVPHCIISMAASVSDILEPMVLLKEVGLIHANGEDPTGSVDVIPLFET
IDDLEGGADILRAVWSIPLYRTYLRNRGDLQEVMLGYSDSNKDGGYFAANWALFNGETQI
VQACREEGLRLRFFHGRGGTVGRGGGPSYDAILAQPAGAVQGAVRVTEQGEIISAKYGSP
ETARRNLEALVSATLEASLMDVNDLDDPQRAAEIMTWLSHASQAAYTRLAHEDPGFIQYF
TESTPVAEIGKLNIGSRPSSRKQTESLDDLRAIPWVLSWSQSRVMLPGWYGVGTALRDFI
EQSEDRDAAVAELRDLAENWPFFASVMSNMAQVMAKADMSLAQMYASLISDQDVARRVFD
AIRAEYELTCEMFAKVTGRDELLADNPELARSVRDRFPYLLPLNVLQVELLRRYRAGDED
PKVPLGIQLAMNGLATALRNSG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggttgacgatcaaaccaacatgcaggacgacatccggttcctcggccgcgtcctcggc
gaggtcatcgccgagcaggagggtcaggagaccttcgacctggtcgagaactcgcgccgg
cgcgccttcgaggtcgcccgcggcgaggccgacatgtccgacctggccgccatgttccac
gacatcgaggccgagaaggcccgcgacgtcatccgcgcattcagccacttcgccctcatg
gcgaacctggccgaggacctctacgacgagtcggcccggctgcaccgccgccaggccggc
gagcccgcccccgcatccaccctcgacgcgacctggcgcaagctggccgaggccggcgtc
gacccggcgacgatctcgcgggagttccccgccacgcaggtcgccccggtgctcaccgcc
cacccgaccgagacccgccgccgcaccgtcttcgacgcccagaagcacatctccgagctc
atgcgccgccggcgcgtgctgctgacggcgggggagaacgccctgaccgccggcgagctc
gaggagatcgagcgcgacgtgcgccgccgcctgaccatcctgtggcagaccgccctgatc
cgcgtcgcccgtccccgcctcgaagacgaggtcgaggtcggcctgcgctactacaagctc
tcgctgctgcaggccatcccgaagctcaaccacgacgtcgtcaagctgctctccgactcc
gcgggcgcgcccgtgccgcagcacccgatcgtgcagcccggctgctggatcggcgccgac
cacgacggcaacccgtacgtcaccggcaccacgctcgactacgcggccacccgcgccgcg
gagaccgtgctgaagtactacgccggccagctgcacgacctcgagcacgagctgagcctg
tccgaccggctcggcgaggtctccgagaagctctacgcgctggccgacgagggccacaac
gacgtgccctcgcgcgtcgacgagccctaccgccgcgccgtccacggcgtgcgcggccgc
atcctggccaccaccgtcggcctgatcggccccgacgccgtcgagggcgactggttcaag
gcccacgagccctacgccgacgccgaggagttcctcgcggacctcgacctcatcgactcc
tgcctgcgcgcggagcacgacgagatcatcgccgacgcccgcctggccgacctgcgcgcc
gccgtgcgcaccttcggcttccacctctacgccctggacatccgccagaactccgagagc
tacgaggacgtgctcaccgagctgttctccctggcgcacgtggccgaggactaccgcggc
ctggacgaggacgcgaagatcaaactgctggtcgacgagctgcgcaccccgcgcccgctc
gtgccggccggctaccacgacttcaccgagcccaccgagcgcgagctcggcatcttccgc
gcggccgccgaggccgtcgacaagttcggccccgagatggtgccgcactgcatcatctcg
atggccgcctcggtcagcgacatcctcgagccgatggtcctgctcaaggaggtcggcctg
atccacgccaacggcgaggacccgaccggttccgtcgacgtcatcccgctgttcgagacc
atcgacgacctcgagggcggcgccgacatcctgcgcgccgtctggtccatcccgctctac
cgcacctacctgcgcaaccggggggacctccaggaggtcatgctcggctactccgactcc
aacaaggacggcggctacttcgccgcgaactgggccctgttcaacggcgagacccagatc
gtgcaggcctgccgcgaggagggcctgcgcctgcggttcttccacggccgcggcggcacc
gtcggccgtggcggcggaccgtcctacgacgcgatcctggcccagccagccggcgccgtg
cagggcgcggtgcgcgtcaccgagcagggcgagatcatctccgcgaagtacggctcgccg
gagacggcgcgccgcaacctcgaggcgctggtctcggccacgctcgaggcctcgctgatg
gacgtcaacgacctcgacgacccgcagcgcgccgccgagatcatgacctggctctcgcac
gccagccaggcggcctacacccgcctggcccacgaggaccccggcttcatccagtacttc
accgagtcgaccccggtcgccgagatcggcaagctgaacatcggctcgcgcccgtcgtcg
cgcaagcagaccgagtcgctggatgacctgcgcgccatcccgtgggtgctgtcctggtcg
cagtcgcgcgtcatgctgcccggctggtacggcgtgggcaccgcgctgcgcgacttcatc
gagcagtccgaggaccgcgacgccgcggtcgccgagctgcgcgacctggccgagaactgg
ccgttcttcgcctcggtgatgtccaacatggcccaggtcatggccaaggcggacatgagc
ctggcgcagatgtacgcctcgctgatctccgaccaggatgtcgcccggcgcgtcttcgac
gccatccgcgccgagtacgagctgacctgcgagatgttcgccaaggtcaccggccgcgac
gagctgctcgccgacaaccccgagctggcccgctccgtgcgcgaccgcttcccgtacctg
ctgccgctcaacgtgctgcaggtcgagctgctgcgccgctaccgcgccggcgacgaggac
ccgaaggtcccgctgggcatccagctggccatgaacggcctggccaccgccctgcgcaac
tccggctag

DBGET integrated database retrieval system