KEGG   Cellulomonas flavigena: Cfla_0817Help
Entry
Cfla_0817         CDS       T01230                                 

Definition
(GenBank) DNA ligase D, 3'-phosphoesterase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cfl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Cfla_0817
Enzymes [BR:cfl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Cfla_0817
DNA repair and recombination proteins [BR:cfl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Cfla_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: ADG73727
UniProt: D5UJY5
LinkDB All DBs
Position
885752..887320
Genome map
AA seq 522 aa AA seqDB search
MRDFTRTAEPEGAPPAPSDAPERRFVVQRHRARRLHYDVRFEVDGVLVSWAVPKGPTLDP
TARRMAVHVEDHPLEYEAFEGVIPRGQYGGGDVIVWDRGTWRPYKTDDPAAEIRGGQLHA
ELFGERLRGKFLLVRRDGEGRGTEQWLMFHKRDEHAVEGWDAEDHPTSVVSGRTNDEVAA
HPDHLWRSGVPAAEAEVDTHPPVPEVAAPSDDELAALDELGTAGTWEVFGRRLKVTNLDK
ELFAGRDGGPPVTKRELLRYAARIAPVALPYLAGRALNMHRFPQGAGTAGFWHKQLPDHA
PAWVPRWDRPDVDPGESTTYLVVDEPAALVWAANFGALEWHAWTSRTSAPDLPTYALVDL
DPGPATAWEDLVLLAGLHRDAFEHVGVRAYPKLTGRRGIQVWVPITVGPSFDETRAWVER
LSRTVGKVVPDLVSWRWEVRERGGQARLDYTQNAVNKTLVAPYSPRAAAGAPVSAPITWD
ELDDPDLRSDTFTVRTVLDRLAERGDPFRGVLAADQHLPPLT
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacttcacgcgcacggccgagccggagggtgcgccgcccgcaccctcggacgcg
cccgagcgccggttcgtcgtgcagcggcaccgcgcgcggcggctgcactacgacgtgcgg
ttcgaggtcgacggggtcctggtgagctgggccgtgcccaagggaccgacgctcgacccg
accgcgcggcgcatggccgtgcacgtcgaggaccacccgctggagtacgaggcgttcgag
ggcgtgatcccgcgcggccagtacggcgggggagacgtcatcgtgtgggaccgcggcacg
tggcgcccctacaagaccgacgacccggcggcggagatccgcggcgggcagctgcacgcc
gagctgttcggcgagcggctgcgggggaagttcctgctggtgcggcgcgacggcgagggg
cgcggcacggagcagtggctgatgttccacaagcgcgacgagcacgccgtcgagggctgg
gacgccgaggaccaccccacgtccgtcgtctcgggccgcaccaacgacgaggtcgccgcg
caccccgaccacctgtggcgctcgggcgtcccggcggccgaggcggaggtcgacacgcac
ccgcccgtgccggaggtcgccgccccgagcgacgacgagctcgcagccctcgacgagctc
ggcaccgcgggcacgtgggaggtcttcggccggcgcctcaaggtcaccaacctcgacaag
gagctgttcgcggggcgcgacggcgggccgcccgtcaccaagcgcgagctgctgcggtac
gccgcccggatcgcgccggtcgcgctgccgtacctcgcgggccgcgcgctcaacatgcac
cgcttcccgcagggcgccggcacggccgggttctggcacaagcagctcccggaccacgcg
ccggcgtgggtgccgcgctgggaccgccccgacgtcgacccgggggagtccaccacgtac
ctcgtcgtcgacgagccggcggcgctggtgtgggccgcgaacttcggcgcgctggagtgg
cacgcgtggacgtcgcggacgagcgcgccggacctgccgacgtacgcgctggtcgacctc
gacccgggccccgcgacggcctgggaggacctggtgctgctcgcgggtctgcaccgcgac
gcgttcgagcacgtcggggtgcgggcgtaccccaagctgaccggcaggcgcggcatccag
gtgtgggtgccgatcaccgtcggtccgtcgttcgacgagacgcgcgcgtgggtcgagcgc
ctgtcgcgcaccgtcggcaaggtcgtgcccgacctcgtgagctggcggtgggaggtgcgc
gagcgcggcgggcaggcgcggctggactacacgcagaacgcggtcaacaagacgctcgtc
gcgccgtacagcccccgcgcggccgccggtgcgcccgtctccgcgccgatcacgtgggac
gagctcgacgacccggacctgcgctcggacacgttcaccgtccgcacggtcctcgaccgg
ctcgcggagcgcggtgacccgttccgcggcgtcctggccgccgaccagcacctgccgccg
ctcacctga

DBGET integrated database retrieval system