KEGG   Cellulomonas flavigena: Cfla_1219Help
Entry
Cfla_1219         CDS       T01230                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00020  Citrate cycle (TCA cycle)
cfl00310  Lysine degradation
cfl00380  Tryptophan metabolism
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01120  Microbial metabolism in diverse environments
cfl01130  Biosynthesis of antibiotics
cfl01200  Carbon metabolism
Module
cfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cfla_1219
  Amino acid metabolism
   00310 Lysine degradation
    Cfla_1219
   00380 Tryptophan metabolism
    Cfla_1219
Enzymes [BR:cfl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Cfla_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N PAD
Motif
Other DBs
NCBI-ProteinID: ADG74121
UniProt: D5UBM6
LinkDB All DBs
Position
complement(1364339..1368091)
Genome map
AA seq 1250 aa AA seqDB search
MTQNAQSDSTRADFGANEWLVDELYEQYLKDRNAVDPAWWDFFEGYKPETTGAATNGETK
DAPRATAAPPAPAQPTTARTPAAPAVPAAPPAPPVEVTPSPVATAQPATAPYAEAATRRT
DAPEVQAVDDVQKLRGPAARVVTNMEASLEVPTATSVRAVPAKLMVDNRIVINNHLSRGR
GGKVSFTHLIGFALVEAVQEMPAMNAAYTLVDGKPGVLQPAHVNLGLAIDLAKPDGSRQL
LVPSIKKAETLDFAQFWTAYEDVVRRARNSKLTVDDFAGTTISLTNPGTIGTVHSVPRLM
QGQGTIVGVGAMDYPAEFAGTSDEQLNRMGVSKVLTVTSTYDHRIIQGAQSGDFLRILGR
KLLGEDGFYDRVFAALRVPYEPVRWVRDANHDPDAEAIKPARVAELIHAYRSRGHLMAET
DPLAYRQRKHPDLDVQNHGLTLWDLDRTFPTGGFTGRTRATLREVLGLLRDSYCRTVGVE
YMHLQDPRQRRWLQERLESGYARTPREDQLRILRRLNAAEAFETFLQTKFVGQKRFSLEG
GESLIPLLDAILSRAADGGLDEVGIGMAHRGRLNVLANIAGKSYGQIFSEFEGNQDPKSV
QGSGDVKYHLGTEGVFTAESGATTAVYLAANPSHLEAVDPVLEGIVRAKQDRIDLGGDGF
SVLPILIHGDAAFAGQGVVFETLNLAQLRGYRTGGTIHVIVNNQVGFTTGPSSSRSSQYA
TDVAKGLQVPIFHVNGDDPEAVVRVAELAFEYREQFDRDVIIDMVCYRRRGHNEGDDPSM
TQPLMYNLIEAKRSVRKLYTETLVARGDITLEEAEQALRDYQSQLERVFTETREDGWTPP
PADVETVAGLERPESQQEDAGVMVGWQTAVPTSILQRIGQAHVSPPEGFTVHPKLAQMLA
KREQMSREGGIDWGFGEILAFGSLLIEGTPVRLAGQDSRRGTFVQRHAVLHDRETGAEWT
PLLYLSGDQAKFWVYDSSLSEYAALGFEYGYSVERPDALVLWEAQFGDFVNGAQTVIDEF
ISSAEQKWAQRSSVVLLLPHGYEGQGPDHSSARIERFLQLAAEDNMTIAQPSTPASHFHL
LRRQAYQRPRRPLVVFTPKSMLRLKSASSDVQDFTSGTFRTVIGDDLAAAKADQVTRVLL
CSGKVYWDLLAQRVAANDQQTAIVRFEQLYPLEPDAIAEALAPFGDAELVWVQDEPRNQG
PWTFVSTHLPQVVGREVRVVSRPESASPAAGSAKKHAVEQKSLVTEAFAR
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcagaacgcgcagtcagactccacccgtgccgacttcggtgcgaacgagtggctg
gtcgacgagctgtacgagcagtacctgaaggaccggaacgcggtggaccccgcgtggtgg
gacttcttcgagggctacaagcccgagacgacgggtgcggcgaccaacggcgagacgaag
gacgcgccccgggcgacggccgcgcccccggcgcccgcgcagcccacgaccgcgcgcacg
ccggcggcacccgccgtcccggctgccccgccggcaccgcccgtcgaggtcaccccgtcg
cccgtcgcgacggcgcagcccgcgacggccccgtacgcggaggcggcgacgcggcgcacc
gacgcgcccgaggtgcaggcggtcgacgacgtgcagaagctccgcggcccggccgcgcgc
gtcgtgaccaacatggaggcctcgctcgaggtcccgaccgcgacgtcggtgcgcgccgtg
ccggccaagctcatggtcgacaaccgcatcgtcatcaacaaccacctgtcgcgcggccgc
ggcggcaaggtctccttcacgcacctcatcggcttcgcgctggtcgaggccgtgcaggag
atgccggccatgaacgcggcgtacacgctcgtcgacggcaagcccggcgtgctgcagccg
gcgcacgtcaacctcggcctggcgatcgacctcgccaagccggacggcagccgccagctc
ctggtgccgtcgatcaagaaggccgagaccctcgacttcgcccagttctggaccgcgtac
gaggacgtcgtgcgccgggcccgcaacagcaagctcacggtcgacgacttcgcggggacg
accatctccctgacgaacccgggcacgatcggcacggtgcactcggtgccgcgcctcatg
cagggtcagggcaccatcgtcggcgtcggcgccatggactacccggcggagttcgccggt
acgtcggacgagcagctcaaccgcatgggcgtctcgaaggtgctgacggtcacgtcgacc
tacgaccaccggatcatccagggcgcgcagtcgggcgacttcctgcgcatcctgggacgc
aagctgctgggcgaggacggtttctacgaccgcgtcttcgcggcgctgcgcgtgccgtac
gagccggtgcgctgggtgcgcgacgcgaaccacgacccggacgccgaggcgatcaagccc
gcgcgcgtcgccgagctcatccacgcctaccgctcgcgcgggcacctcatggcggagacc
gacccgctcgcctaccgccagcgcaagcacccggacctcgacgtgcagaaccacggcctg
acgctgtgggacctcgaccgcacgttccccaccggcggcttcacgggtcggacacgtgcc
acgctgcgcgaggtgctcgggctgctgcgcgactcgtactgccgcacggtcggcgtcgag
tacatgcacctgcaggacccgcggcagcgccgctggctgcaggagcgactggagtcgggg
tacgcgcgcacgccgcgcgaggaccagctgcggatcctgcgccgcctcaacgccgccgag
gcgttcgagaccttcctgcagaccaagttcgtcgggcagaagcgcttctcgctcgagggc
ggcgagtcgctcatcccgctgctcgacgcgatcctgtcgcgcgctgccgacggcgggctc
gacgaggtcggcatcggcatggcccaccgcggtcgcctcaacgtgctggccaacatcgcc
ggcaagtcctacggccagatcttcagcgagttcgagggcaaccaggacccgaagtcggtc
cagggctcgggcgacgtgaagtaccacctcggcaccgagggtgtgttcacggccgagtcc
ggtgcgacgaccgccgtgtacctggcggcgaacccgtcgcacctcgaggcggtcgacccg
gtgctcgagggcatcgtgcgcgccaagcaggaccgcatcgacctgggcggcgacggcttc
tcggtgctgccgatcctcatccacggcgacgccgcgttcgcggggcagggcgtggtcttc
gagacgctcaacctcgcgcagctgcgcgggtaccgcacaggcggcacgatccacgtcatc
gtcaacaaccaggtcggcttcaccaccggcccgtcgtcgtcgcgctcgtcgcagtacgcc
accgacgtggccaagggcctgcaggtgccgatcttccacgtgaacggggacgaccccgag
gccgtggtgcgcgtcgccgagctcgcgttcgagtaccgcgagcagttcgaccgcgacgtc
atcatcgacatggtctgctaccgccgtcgcggtcacaacgagggcgacgacccgtcgatg
acgcagccgctgatgtacaacctcatcgaggcgaagcgctcggtgcgcaagctctacacc
gagacgctcgtggcccgtggcgacatcacgctggaggaggcggagcaggcgctgcgcgac
taccagtcgcagctcgagcgcgtgttcaccgagacccgcgaggacggctggacgcccccg
cccgccgacgtcgagaccgtcgccggcctcgagcgcccggagtcgcagcaggaggacgcc
ggtgtcatggtcggctggcagacggccgtgccgacctcgatcctgcagcgcatcggccag
gcccacgtcagcccgcccgagggcttcacggtgcacccgaagctcgcgcagatgctcgcc
aagcgcgagcagatgagccgcgagggcggcatcgactggggcttcggcgagatcctcgcg
ttcggctcgctgctgatcgagggcacgccggtgcgcctggccgggcaggactcgcgccgc
ggcacgttcgtgcagcgccacgcggtgctgcacgaccgcgagacgggcgccgagtggacg
ccgctgctctacctgtccggcgaccaggccaagttctgggtctacgactcctccctgtcg
gagtacgccgccctcggcttcgagtacggctactccgtcgaacgccctgacgccctggtg
ctgtgggaggcgcagttcggcgacttcgtcaacggcgcccagaccgtcatcgacgagttc
atctcgtcggccgagcagaagtgggcgcagcgctcgtcggtggtgctcctgctcccccac
ggctacgagggccaggggccggaccactcgtcggcacgcatcgagcgcttcctgcagctc
gccgccgaggacaacatgacgatcgcgcagccgtcgacgcccgcgtcgcacttccacctg
ctgcgccgtcaggcgtaccagcggccgcgccgcccgctcgtggtgttcaccccgaagtcg
atgctgcggctgaagtccgcgtcgtcggacgtgcaggacttcacgtcgggcacgttccgc
accgtgatcggcgacgacctcgcggccgccaaggccgaccaggtgacgcgcgtgctgctc
tgctcgggcaaggtctactgggacctgctcgcgcagcgcgtcgcggcgaacgaccagcag
acggcgatcgtgcggttcgagcagctctaccctctcgagcccgacgcgatcgccgaggcg
ctggcgccgttcggcgacgccgagctggtgtgggtgcaggacgagccgcgcaaccagggc
ccgtggacgttcgtgtcgacgcacctgccgcaggtcgtcgggcgtgaggtgcgggtggtg
tcccgcccggagtcggcctcgccggcggccgggtcggccaagaagcacgcggtggagcag
aagtcgctcgtcacggaggccttcgctcgctga

DBGET integrated database retrieval system