KEGG   Cellulomonas flavigena: Cfla_1252Help
Entry
Cfla_1252         CDS       T01230                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
cfl  Cellulomonas flavigena
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ADG74152
UniProt: D5UBQ7
LinkDB All DBs
Position
complement(1397666..1398712)
Genome map
AA seq 348 aa AA seqDB search
MPPVAPMLAKSVKEIPDTGHVEPKWDGFRTIVFRDEDDVELGSRNGKPMTRYFPELVEAL
KENLPERCVLDGEIVVVTGDRLDFDALQQRIHPAASRVKLLAGQTPASFVAFDLLALGDD
DLTGRPFSERRARLVEALAGARPPVHVTRATGDMAEAQRWFTQFEGAGLDGVVAKPLDAP
YQPDKRAMFKIKHERTADCVVAGFRWHKTGDVVGSLLLGLWNDEGRLQHVGVSASFPMAR
RRTLLDDLAPYRDVDLADHPWGAWADQQAHADNRLPGAVSRWNATKDLSFVPLRPELVVE
VAYDHMEGDRFRHTAQFRRWRTDRDPRTCTYEQLDEPVGYDLADVLGG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgtcgcgccgatgctggcgaagtcggtcaaggagatccccgacaccggccac
gtcgagccgaagtgggacggcttccgcacgatcgtcttccgcgacgaggacgacgtggag
ctgggcagccgcaacggcaagccgatgacgcggtacttccccgagctcgtcgaggcgctc
aaggagaacctgccggagcgctgcgtgctcgacggggagatcgtcgtcgtcacgggcgac
cgcctcgacttcgacgcgctccagcagcgcatccaccccgcggccagccgcgtgaagctg
ctggccgggcagaccccggcgtcgttcgtcgcattcgacctcctggcgctgggcgacgac
gacctcacgggccgcccgttctccgagcgccgcgcccggctcgtcgaggccctcgccggc
gcccgtcccccggtccacgtcacgcgcgcgaccggcgacatggccgaggcacagcgctgg
ttcacgcagttcgagggcgccggcctcgacggcgtcgtcgccaagcccctggacgcgccg
taccagccggacaagcgcgcgatgttcaagatcaagcacgagcgcactgccgactgcgtg
gtcgccgggttccgctggcacaagaccggcgacgtcgtcgggtcgctgctgctcggcctg
tggaacgacgagggccgcctgcagcacgtcggggtcagcgcgtcgttccccatggcacgg
cgccgcacgctgctcgacgacctcgcgccctaccgggacgtcgacctggccgaccacccg
tggggcgcgtgggccgaccagcaggcgcacgccgacaaccgcctgcccggcgcggtgagc
cggtggaacgccaccaaggacctgtcgttcgtgccgctgcgccccgagctcgtcgtcgag
gtcgcgtacgaccacatggagggcgaccggttccggcacacggcgcagttccgccgctgg
cgcaccgaccgcgacccgcgcacgtgcacctacgagcaactcgacgagcctgtcggctac
gacctcgcggacgtcctcggcggctga

DBGET integrated database retrieval system