KEGG   Cellulomonas flavigena: Cfla_1917Help
Entry
Cfla_1917         CDS       T01230                                 

Definition
(GenBank) succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00020  Citrate cycle (TCA cycle)
cfl00190  Oxidative phosphorylation
cfl00650  Butanoate metabolism
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01120  Microbial metabolism in diverse environments
cfl01130  Biosynthesis of antibiotics
cfl01200  Carbon metabolism
Module
cfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cfl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cfla_1917
   00650 Butanoate metabolism
    Cfla_1917
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Cfla_1917
Enzymes [BR:cfl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Cfla_1917
    1.3.5.4  fumarate reductase (quinol)
     Cfla_1917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 NAD_binding_8 GIDA HI0933_like AlaDh_PNT_C Vault_4 Pyr_redox FAD_binding_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADG74813
UniProt: D5UF03
LinkDB All DBs
Position
complement(2130630..2132624)
Genome map
AA seq 664 aa AA seqDB search
MTPRPEATSTATTLGPDDVRTVGTPVDGHVPDVAPDLAWDDRRLHYDLVAPANRRRFTVI
VVGTGLAGAGAAAALGELGYQVECFTLHDAPRRAHSVAAQGGINAARARKVDNDSLHRFV
KDTVKGGDFRGREADAFRLAQESVRVIDHMNAIGAPFAREYGGRLATRSFGGVQVSRTYY
TRGQTGQQLQVAGADALLRQVARGTVTLHTRQEMLDLVVADGRAQGVVVRDLVTGKVRAV
TAHAVILATGGYGNIYDKSTLARNSNATAAWRAHRRGAYFANPAFVQFHPTALPLMSQWQ
SKTILMSESLRNDGRIWVPLRADDDRAPQDVPEDERDYYLERRYPTFGNLTPRDVASRAA
RERIDAGYGVGPLKNAVYLDFADAIARLGKDAVVARYSNLFHMYQQATGDDPLSTPMRIA
PGAHFAMGGLWSDYDLMTSVPGLFVGGEVGWGYHGANRLGANSLLSACVDGWFTLPYAVP
SYLAPLLGTPALAPDHDAVAESLDAVRSRTGRLLSTGGTQGPARFHRRLGEILYRSAGVT
RTPEGLAEGIADVRALREEFWQDVRVTGEGDVLNQELERAGRVADYLEMAELLCVDALDR
DESCGAHFRADHQTPGGEAQRDDAAWCRVSAWESPAPGATDARFVRHDEPLTFQAVPLQT
RNYA
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaccccccgacccgaggcgacgtccaccgccacgacgctcggcccggacgacgtccgc
acggtcggcacccccgtcgacggacatgtgcccgacgtcgcgccggacctggcgtgggac
gaccggcgcctgcactacgacctcgtcgccccggccaaccgtcgcaggttcacggtcatc
gtggtgggcacaggcctcgccggcgcgggcgccgcggcggcgctcggtgagctcggctac
caggtggagtgcttcacgctccacgacgccccgcgccgcgcgcactccgtggcggcgcag
ggcggcatcaacgccgcccgcgcccgcaaggtcgacaacgactcgctgcaccgcttcgtc
aaggacaccgtcaagggcggcgacttccgcggccgcgaggccgacgccttccggctcgcg
caggagtcggtgcgggtcatcgaccacatgaacgcgatcggtgcgccgttcgcccgggag
tacggcgggcggctcgcgacgcggtcgttcggcggcgtgcaggtgtcgcgcacgtactac
acgcgcggccagaccggtcagcagctgcaggtcgccggcgccgacgcgctgctgcgccag
gtcgcgcggggcaccgtcacgctgcacacgcgtcaggagatgctcgacctggtcgtcgcc
gacggacgtgcccagggcgtcgtcgtgcgggacctcgtcaccgggaaggtcagggccgtc
accgcgcacgccgtgatcctggcgacgggcggctacggcaacatctacgacaagtcgacg
ctcgcgcggaactccaacgcgaccgccgcctggcgtgctcaccgccgcggtgcgtacttc
gcgaaccccgcgttcgtgcagttccaccccaccgcgctgccgctcatgagccagtggcag
tccaagacgatcctcatgtcggagtcgctgcgcaacgacggccggatctgggtgccgctg
cgtgccgacgacgaccgtgcaccgcaggacgtccccgaggacgagcgggactactacctc
gagcgccggtacccgacgttcggcaacctcacgccgcgcgacgtcgcgtcccgcgcagcc
cgcgagcgcatcgacgccggctacggggtgggtccgctgaagaacgccgtgtacctcgac
ttcgccgacgcgatcgcgcggctcggcaaggacgccgtcgtggcgcggtactcgaacctc
ttccacatgtaccagcaggccacgggcgacgatccgctgagcacgccgatgcggatcgcg
ccgggggcgcacttcgcgatgggtggcctgtggtcggactacgacctcatgacgtcggtg
ccggggctgttcgtcgggggggaggtcggctggggctaccacggggcgaaccggctggga
gcgaactcgctgctgtcggcgtgcgtcgacggctggttcacgctgccgtacgcggtgccg
agctacctggcgccgctgctgggcacgccggcgctcgcgccggaccacgacgcggtcgcc
gagtcgctcgacgcagtgcgttcccgcacgggccggctgctgtcgacgggtggcacccag
ggcccggcgcggttccaccggcggctgggggagatcctctaccgctccgccggtgtgacg
cggacgccggagggcctcgcggaggggatcgccgacgtccgcgcgctgcgggaggagttc
tggcaggacgtgcgggtcaccggcgagggcgacgtcctcaaccaggagctcgagcgggcc
ggccgcgtggcggactacctcgagatggccgagctgctgtgcgtcgacgccctcgaccgt
gacgagagctgcggcgcgcacttccgtgccgaccaccagacgcccggcggcgaggcacag
cgcgacgacgcggcctggtgccgcgtctcggcgtgggagtcgcccgcccccggcgccacc
gacgcgcggttcgtacggcacgacgaaccgctgacgttccaggccgtgcccctgcagacg
aggaactacgcgtga

DBGET integrated database retrieval system