KEGG   Cellulomonas flavigena: Cfla_2528Help
Entry
Cfla_2528         CDS       T01230                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00020  Citrate cycle (TCA cycle)
cfl00480  Glutathione metabolism
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01120  Microbial metabolism in diverse environments
cfl01130  Biosynthesis of antibiotics
cfl01200  Carbon metabolism
cfl01210  2-Oxocarboxylic acid metabolism
cfl01230  Biosynthesis of amino acids
Module
cfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cfla_2528
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cfla_2528
Enzymes [BR:cfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Cfla_2528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADG75416
UniProt: D5UI71
LinkDB All DBs
Position
complement(2836403..2837671)
Genome map
AA seq 422 aa AA seqDB search
MSSNLGDTPTAQEAGPRMAKIKVVGPVVELDGDEMTRIIWQFIKDRLIHPYLDVDLRYYD
LSIQNRDATDDQVTIDAAHAIKEHGVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNIL
GGVVFREPIIISNIPRLVPGWNKPIIIGRHAHGDQYKATNFKVPGAGTLTLTYTPADGSE
PIHQEVVTYPEAGGVAMGMYNFNESIRDFARASFAYGLQRGYPVYLSTKNTILKAYDGAF
KDIFQEVFDAEFKEQFDAAGLTYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQ
GFGSLGLMTSVLMTPDGRTVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIFAWTGGLKHR
GKLDGTPEVTQFAETLEDVVITTVESGKMTKDLALLVGKDQPWLTTEEFLAALDENLAAR
LG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaacctgggggacacacccacggcacaggaggcaggcccccgcatggcgaag
atcaaggtcgtcggcccggtcgtcgagctcgacggcgacgagatgacgcgcatcatctgg
cagttcatcaaggaccgcctgatccacccgtacctcgacgtcgacctgcgctactacgac
ctgtcgatccagaaccgcgacgccaccgacgaccaggtgacgatcgacgcggcgcacgcc
atcaaggagcacggcgtcggcgtcaagtgcgcgacgatcacgcccgacgaggcgcgcgtc
gaggagttcggcctgaagaagatgtgggtctcgcccaacggcacgatccgcaacatcctc
ggcggcgtcgtcttccgcgagccgatcatcatctcgaacatcccgcgcttggtcccgggc
tggaacaagccgatcatcatcggccgtcacgcccacggcgaccagtacaaggcgaccaac
ttcaaggtcccgggtgccggcacgctgacgctgacctacaccccggcggacggctcggag
ccgatccaccaggaggtcgtgacgtaccccgaggccgggggcgtcgccatgggcatgtac
aacttcaacgagtcgatccgcgacttcgcgcgcgcctcgttcgcgtacggcctgcagcgt
gggtaccccgtgtacctgtcgacgaagaacacgatcctcaaggcgtacgacggtgccttc
aaggacatcttccaggaggtgttcgacgccgagttcaaggagcagttcgacgccgccggc
ctgacgtacgagcaccgcctcatcgacgacatggtggccgccgccatgaagtgggagggc
ggctacgtctgggcgtgcaagaactacgacggcgacgtgcagtccgacaccgtcgcgcag
ggcttcggctcgctgggcctcatgacgtccgtcctcatgacgccggacggcaggaccgtc
gaggcggaggccgcgcacggcaccgtgacgcgccactaccgccagcaccaggcgggcaag
ccgacgtcgaccaacccgatcgcgtcgatcttcgcgtggaccggtggcctcaagcaccgc
ggcaagctcgacggcacgcccgaggtcacgcagttcgccgagaccctcgaggacgtcgtc
atcacgaccgtcgagagcggcaagatgaccaaggacctcgcgctgctcgtcggcaaggac
cagccgtggctcaccacggaggagttcctcgccgcgctcgacgagaacctggccgcgcgc
ctgggctga

DBGET integrated database retrieval system