KEGG   Clostridium formicaceticum: BJL90_07135Help
Entry
BJL90_07135       CDS       T05005                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
cfm  Clostridium formicaceticum
Pathway
cfm00290  Valine, leucine and isoleucine biosynthesis
cfm00770  Pantothenate and CoA biosynthesis
cfm01100  Metabolic pathways
cfm01110  Biosynthesis of secondary metabolites
cfm01130  Biosynthesis of antibiotics
cfm01210  2-Oxocarboxylic acid metabolism
cfm01230  Biosynthesis of amino acids
Module
cfm_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
cfm_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:cfm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BJL90_07135
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BJL90_07135
Enzymes [BR:cfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     BJL90_07135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD NodS
Motif
Other DBs
NCBI-ProteinID: AOY75688
UniProt: A0A1D9FJX3
LinkDB All DBs
Position
1529862..1531532
Genome map
AA seq 556 aa AA seqDB search
MMKINNTYQGPDRAPHRSLFYAMGYLPEDLKKPIIGVVNAHNEVIPGHFHLDEIAQAVKL
GVSAGGGTPMEFPVIGICDGIAMNHSGMKYPLSTRELIADSIEAMTVGYKFDGLVLIGNC
DKIVPGMMMAAARMNIPAIYISGGPMLTGSHKGKTVDLIRGAFEAVGSYAEGNIDAQQLE
EIEMESCPTCGSCAGMFTANTMNCLAEALGIGLPGNGTIPAPYGQRKQLARRAGLQIMEL
VKENIRPRDILTLGAFRNAVTVDMAIGGSSNTVLHLMAIANEAKVPLSLEVFDEISRKVA
NITKLSPAGTYSITDLHRAGGISAVINQLIKAGMVYPDEITVTGKTLGESVAKASVWDND
VIRDMDNPYNKEGGIAILRGNLAPDGAVIKQSAVEPEMMVHKGPARVFESEEEAYDAIIS
KKIKSGDVVVIRYEGPKGGPGMREMLSPTAAIVGMGLEKSVALITDGRFSGGTRGPCIGH
VSPEASEGGPIGIIQEGDMIEIDIPNRILKVDLSDEEIQNRQKDWKQPPSKAEEGTYLYR
YSKLVTSASTGAVFKY
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaattaacaatacttatcaaggtccagatcgagcaccccatcgttctttattt
tacgctatgggctatttgccagaggatttaaaaaaaccaattattggggttgttaatgcc
cataatgaagtaattccaggacactttcatttagatgagatagcacaggcggtgaagcta
ggggtaagtgccgggggtggaacccctatggaatttcctgtgattggtatatgtgatggt
attgccatgaatcatagtggcatgaagtatccattgtctactagagagttgattgctgat
tctattgaagccatgacagtaggttataaatttgatggtctagttctaataggaaactgt
gataaaatcgtgccggggatgatgatggcagctgccagaatgaatatacctgctatctat
attagtggtggccctatgctgacaggaagccataagggaaagacagtggacttaattaga
ggtgctttcgaagcagtaggttcttatgcggaaggaaatattgatgcacaacaattagag
gaaattgaaatggaatcctgtccaacttgtggcagctgtgctgggatgtttactgccaac
accatgaattgccttgcagaggctctaggaataggtcttccaggaaatggaacgatacca
gcaccctatggacaaagaaagcaattggcaagaagagcgggacttcaaattatggagttg
gtaaaggaaaatattcgacctagagatattttaaccctaggggcctttagaaatgctgtt
actgtagatatggctataggtggttcctccaatacagtgctgcatcttatggcgattgcc
aatgaagcaaaggtacctttaagtcttgaggtgtttgacgaaatcagtagaaaagttgcc
aatatcacgaagttaagtcctgctggcacctatagtataacagatcttcacagggcggga
gggatctctgctgttatcaatcaattaattaaagcaggtatggtctatcccgatgaaatt
actgttactggcaaaacattaggggaaagtgtggcaaaggcatcggtttgggataatgat
gttattcgtgatatggacaatccttataacaaagaaggtggtattgccattcttagaggt
aaccttgcaccagatggagctgttatcaaacaatcggcagtagagcctgaaatgatggtg
cacaaaggaccagcaagggtatttgaatcagaagaagaggcttatgatgccattatcagt
aagaagatcaaatcaggcgatgtggtagtcatccgttacgaaggccctaaaggtggccct
ggtatgagggaaatgctaagtcctactgctgctatcgtaggtatgggcttagaaaaatct
gttgccttaattactgatggacgtttttctgggggtacgagaggaccctgtataggacat
gtttctccagaggcatcagaggggggaccgatagggattattcaagaaggagatatgatt
gaaattgatattcccaacaggatattgaaggtagatttaagtgacgaagaaatacaaaac
cgtcaaaaggattggaagcaaccaccttcaaaggcagaagagggaacttatctatatcgc
tatagcaagttagttacctctgccagtacaggagcagtatttaagtactaa

DBGET integrated database retrieval system