KEGG   Clostridium formicaceticum: BJL90_16815Help
Entry
BJL90_16815       CDS       T05005                                 

Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cfm  Clostridium formicaceticum
Brite
KEGG Orthology (KO) [BR:cfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfm01001]
    BJL90_16815
Enzymes [BR:cfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BJL90_16815
Protein kinases [BR:cfm01001]
 Serine/threonine kinases: Other
  Bacterial family
   BJL90_16815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Kdo GET2 ETRAMP Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AOY77367
UniProt: A0A1D9FPS0
LinkDB All DBs
Position
complement(3603734..3605707)
Genome map
AA seq 657 aa AA seqDB search
MIGKILGGRYEIVEKVGGGGMALVYKAKCNLLNRYVAVKILRSEFTSDKDIIEKFKRESQ
AAASLSHPNIVNLYDVGEEDDIYYIVMEYVKGRTLKEVIKEKGILTLNEIINYTKQIALA
LQHAHYNHVIHRDIKPHNILITEDNRAKVTDFGIAIAASSSTITNMGSVIGSVHYFSPEQ
ARGGYIDEKSDLYSLGIVMYEMATGTVPFEGDSPITVALKHIQQDPVPPSEVYPAISKNL
EEIILKLMQKDQASRYQNAQSLIVSLGKLKEDAVDNEMTMMLNHEDSPTQIIPRIKEEDF
EVPKVSAPKPAPKSKKSNNKLVIAAAIVAALIAALLFTFGLFYVSNLNFFRTEEVVVPGL
EGKNIEEAREIVKELGLQLEERSTHTTETPINEIISQETNAGMKVKPGYTIRVVVSAGPD
MANVPDLIHEDAVNVPLLLANRGLKAGTPREEFSEFPIGTVIDQNPRGGSSLPAGSTVDY
VVSKGPQVVTFSMPTLIGETRERAEAILRQQQLEIGNVSEGDSNEYAKGLVIFQSIPPET
QVSQNTVVNLIISRGPEVIQEPEDITPPEDEPEEGQEEEQSASTNLSTQNVTIQLQGHKG
IVELVIKRVSDGGEIYNRSHNVDNEGNRITIPVTGYPKEEFELFVNGQKHSKNIKLK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaaaatattaggtggtcgctatgaaattgttgaaaaagtcggcggaggcggc
atggctttagtttacaaagccaaatgtaatttattaaatagatatgtagcagtgaaaata
ttaagatcagagtttaccagtgataaagacatcatagaaaaatttaaaagagagtctcaa
gctgctgcaagtctgtcgcatcccaatattgtaaacctatatgatgttggggaagaagat
gatatttactatattgtcatggaatatgttaaaggaagaacgctgaaggaagtaataaaa
gaaaaaggtatcctcaccttaaatgagattattaattacacaaagcagattgcactagca
ttacaacatgcccattataatcatgtgattcatagggatattaaaccccataatatttta
attacagaggataatagagctaaagtaacggattttggtattgcaattgctgctagttct
tctaccataaccaatatgggcagtgttataggctctgttcattatttttctccagagcag
gctagaggcggttatatagacgaaaaatcagacttatattcattgggaattgttatgtat
gaaatggctacaggaacagtgccttttgaaggagacagtcctataacggtggctttaaag
cacattcaacaggacccagttcctccttcagaagtttatccagcaatatctaaaaattta
gaagaaattatattaaagttgatgcagaaggatcaggcttctaggtatcaaaatgctcag
agtttaatcgtgagcctgggtaagttaaaggaagatgctgttgataatgagatgacaatg
atgttaaatcatgaagattcaccaacacaaattataccccgcattaaggaggaagacttt
gaagtgcccaaagtatctgcacccaaacctgcacccaaaagtaaaaaaagcaataataag
ctggtcattgccgctgcaattgtagctgctctaattgcagccctgttgtttacctttgga
cttttttatgtaagcaaccttaacttttttagaacagaagaagtagtagttcctggcttg
gaaggtaagaatattgaggaagccagagaaatcgtgaaggaacttgggttacaattggaa
gaaagatctacccatactacagagaccccaataaatgaaattatcagtcaagaaaccaat
gccggtatgaaggtaaagcctggttatacaattcgggtagtggtaagtgcagggcccgat
atggcgaatgtgccagatctgatccatgaagatgcagtaaatgtccccttgttgctggca
aatagaggtttgaaggcggggacaccaagagaagaattcagtgaatttcctattggtact
gtaatagaccaaaaccctagaggaggatcttctctaccggcaggatcgacggttgattat
gttgttagcaagggaccgcaagtggtgactttctcaatgcctactctaataggtgaaact
agagaacgtgctgaggctatactaagacaacagcaactggaaataggaaatgtctcagaa
ggagatagtaatgagtacgcaaaaggtcttgtgatctttcaaagtattccaccggaaaca
caagtatctcaaaatactgttgtgaacttaatcatcagtaggggaccggaagtgatacag
gaaccggaggatataacaccacctgaagatgaacctgaggaagggcaggaggaagagcaa
agtgcatcgacaaatttatctactcaaaatgtaacgatacagttgcaaggacataaaggc
attgtagaacttgtcatcaagagagtatcagatggaggggaaatatacaacaggagccat
aatgtagataatgaaggcaatagaataacaatacctgtcacaggctatccaaaagaagag
tttgaactttttgtaaatggtcaaaaacatagcaaaaatataaaattaaaatag

DBGET integrated database retrieval system