KEGG   Corynebacterium falsenii: CFAL_00985Help
Entry
CFAL_00985        CDS       T03037                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cfn  Corynebacterium falsenii
Pathway
cfn00071  Fatty acid degradation
cfn00280  Valine, leucine and isoleucine degradation
cfn00281  Geraniol degradation
cfn00310  Lysine degradation
cfn00362  Benzoate degradation
cfn00380  Tryptophan metabolism
cfn00410  beta-Alanine metabolism
cfn00640  Propanoate metabolism
cfn00650  Butanoate metabolism
cfn00903  Limonene and pinene degradation
cfn00930  Caprolactam degradation
cfn01100  Metabolic pathways
cfn01110  Biosynthesis of secondary metabolites
cfn01120  Microbial metabolism in diverse environments
cfn01130  Biosynthesis of antibiotics
cfn01200  Carbon metabolism
cfn01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CFAL_00985
   00650 Butanoate metabolism
    CFAL_00985
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFAL_00985
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFAL_00985
   00310 Lysine degradation
    CFAL_00985
   00380 Tryptophan metabolism
    CFAL_00985
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFAL_00985
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CFAL_00985
   00281 Geraniol degradation
    CFAL_00985
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFAL_00985
   00930 Caprolactam degradation
    CFAL_00985
Enzymes [BR:cfn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CFAL_00985
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CFAL_00985
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CFAL_00985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH Peptidase_S49 NAD_binding_2 2-Hacid_dh_C UDPG_MGDP_dh_N NAD_binding_8 LPD26 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AHI02363
UniProt: W5WNA8
LinkDB All DBs
Position
complement(234748..237129)
Genome map
AA seq 793 aa AA seqDB search
MSENMFGWDVDADGILTLTMDDPNAPVNTMNQTFQDALTPTVEKIKSGVESGEIKGVVIT
SAKKTFFAGGDIKSMIKATPADAEALTKQIDGMKADLRALETLGVPVVAAMNGAALGGGL
EIALATHHRIATDAKGAKFGLPEVTLGLLPGGGGVTRVVRMLGIQDALMKVLTTGKQFTA
EAAVKAGLIDEVVPADQLIDTAKTWIKNNPEATQPWDQKGYKIPGGTPSTPALAQFLPSF
PANVTKQIKGAPMPAPKAILKAAVEGAQLRNIEEATRVETRYFVELVTGPTAKNMMQAFF
FDLQYINGGGSRPKNASGEKFEKTQFKKLGMVGAGMMGAGIAYVAAKAGMEVVLKDIKIE
AAEKGKSYSEGLEKKALERGRTTEEKSKALLDRIKPTTDYADLSDCDIVIEAVFENTELK
HKVWAEIEAAVPSDCVLGTNTSTLPITGLAEGVERKGDFIGIHFFSPVDKMPLIELISGE
QTEDATLAKALDFAAQIRKTPIVVNDSRGFYTSRVIGFFLNEAMRMLVEGVDPAVIEAAG
RQAGYPAPPLQLQDELNLKLARKINSETKAAQEAAGISVDDGGVTGIIDKMLDEYDRPGK
LEGKGFYEYNEEGRRTGLWRGLWDELGAGTVKVADAESALSGHGLDTAAAGAVKKAAGHA
SAGDGNEEGISTGTPAGADVPAEAPAFIDLIERMLFSEALETQKCLDEGVLTSDADANIG
SIMGIGFPAWTGGTRQYIKNYARPAAATLPEGKTADVDGGDYPTTGVAGFVARAEELAAK
YGERFTPLDSLKG
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaacatgttcggatgggacgtggatgctgacggcatcctcaccctcaccatg
gacgaccccaacgcgccggtcaacaccatgaaccagaccttccaggacgcgctgaccccc
accgtggaaaagatcaagtccggcgtggaatccggcgagatcaagggcgtggtcatcacc
agcgcgaagaagaccttcttcgccggcggcgacatcaagtccatgatcaaggccaccccg
gcagacgccgaagccctcaccaaacagatcgacggcatgaaggctgacctgcgcgcactc
gaaaccctcggcgtgcccgtggtcgcggcgatgaacggcgcggcgctcggcggcggcctc
gagatcgccctggcgacccaccaccgcatcgccaccgacgcgaagggcgccaagttcggc
ctgcccgaagtcaccctcggcctgctgcccggcggtggcggcgtgacccgcgtggtgcgc
atgctcggcatccaggacgccctcatgaaggtcctgaccactggcaagcagttcaccgcc
gaggccgccgtgaaggccgggctcatcgacgaggtcgtgcccgccgaccaactcatcgac
accgccaagacctggatcaagaacaaccccgaagcaacccagccctgggaccagaagggc
tacaagatccccggcggcaccccctccaccccggcgctggcgcagttcctgcccagcttc
ccggcgaacgtcaccaagcagatcaagggcgccccgatgcccgcgccgaaggccatcctc
aaggccgctgtggaaggcgcgcagctgcgcaacatcgaagaagccacccgcgtggaaacc
cgctacttcgtggaactggtcaccggcccgaccgcgaagaacatgatgcaggcattcttc
ttcgacctgcagtacatcaacggcggcggctcccgcccgaagaacgcctccggcgagaag
ttcgaaaagacccagttcaagaagctgggcatggtcggcgccggcatgatgggcgcaggc
atcgcctacgtggcggccaaggccggcatggaagttgtgctcaaggacatcaagatcgag
gccgcggaaaagggcaagtcctactccgagggcctggagaagaaggccctggagcgcggc
cgcaccaccgaggagaagtccaaggcgctgctggaccgcatcaagcccaccaccgactac
gcagacctgtccgactgtgacatcgtcatcgaggccgtgttcgagaacaccgagctcaag
cacaaggtctgggccgaaatcgaggccgctgtgccctccgattgcgtgctcggcaccaac
acctccaccctgcccatcaccggcctggccgagggcgtggagcgcaagggtgacttcatc
ggcatccacttcttctcccccgtggacaagatgccgctcatcgagctgatctccggcgag
cagaccgaggacgccaccctggccaaggccctcgacttcgccgcccagatccgcaagacc
cccatcgtggtcaacgactcccgcggcttctacacctcgcgcgtcatcggcttcttcctc
aacgaagctatgcgcatgctcgtcgaaggcgtggacccggcagtcatcgaggcagcaggc
cgccaggcaggctaccccgccccgccgctgcagctgcaggacgagctgaacctcaagctg
gcccgcaagatcaactccgagaccaaggcagcccaggaggccgctggcatctccgtggac
gatggcggtgtgaccggcatcatcgacaagatgctcgacgagtacgaccgccccggcaag
ctcgagggcaagggcttctacgagtacaacgaggaaggccgccgcaccggcctgtggcgc
ggcctgtgggacgagctgggcgctggcaccgtcaaggtcgccgatgccgagtccgccctc
tccggccacggcctggacaccgctgccgcaggtgccgtgaagaaggctgcaggccacgcc
tccgccggcgacggcaacgaagagggcatctccaccggcacccccgccggcgcggacgtg
cccgccgaggctccggccttcatcgacctgatcgagcgcatgctgttcagcgaggctctg
gagacccagaagtgcctcgatgaaggcgtgctgaccagcgatgcagatgccaacatcggc
tccatcatgggcatcggcttccccgcatggaccggcggcacgcgccagtacatcaagaac
tacgcgcgcccggccgccgctactttgccggagggcaagaccgctgacgttgacggcggg
gactacccgaccaccggcgttgcaggtttcgttgcccgcgccgaggagctggccgccaag
tacggcgagcgcttcaccccgctggattccctgaagggctag

DBGET integrated database retrieval system