KEGG   Corynebacterium falsenii: CFAL_02305Help
Entry
CFAL_02305        CDS       T03037                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
cfn  Corynebacterium falsenii
Pathway
cfn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cfn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CFAL_02305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfn02000]
    CFAL_02305
Enzymes [BR:cfn01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     CFAL_02305
Transporters [BR:cfn02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    CFAL_02305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_29 AAA_25 Rad17 AAA_15 RsgA_GTPase AAA_30 AAA_16 AAA_18 AAA_33 AAA_23 AAA_28 PRK Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: AHI02584
UniProt: W5WMZ2
LinkDB All DBs
Position
543500..544276
Genome map
AA seq 258 aa AA seqDB search
MAKRLDLNDVDIFYGDFHAVKNVNLHIPPKAVTAFIGPSGCGKSTVLRTLNRMHEVIPGA
TVTGEILLDGENIYDPKVDPVSVRNTIGMVFQKANPFPTMSIEENVVAGLKLSGEKNRKK
LRETAERALRGANLWEEVKDRLDKPGGGLSGGQQQRLCIARAIAVEPEVLLMDEPCSALD
PISTLAVEDLIHELKEEFTIVIVTHNMQQAARVSDQTAFFSLEATGKPGNLVEVGPTKKI
FENPEKSETEDYISGRFG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggctaagcgccttgacctcaatgacgtggacatcttctacggtgatttccacgccgtg
aaaaacgttaacctgcacatcccgccgaaggccgtgaccgccttcatcggcccgtccggc
tgtggcaagtccacggtgctgcgcaccctgaaccgcatgcacgaggtcatcccgggcgcc
accgtcaccggtgagatcctcctcgacggtgagaacatctacgaccccaaggtggacccg
gtatccgtccgtaacaccatcggcatggtgttccagaaggctaaccccttcccgaccatg
tccatcgaggaaaacgttgttgctggactgaagctgtccggcgagaagaacaggaagaag
ctccgcgaaacggccgagcgtgccctgcgcggcgcgaacctctgggaagaggtaaaggac
cgtctcgacaagccgggcggcggcctgtccggtggtcagcagcagcgtctgtgcatcgcc
cgggcgatcgccgttgagcccgaggtgctgctcatggacgagccttgctccgctctggac
ccgatctcgaccctcgccgtggaggacctcatccacgagctgaaggaagagttcacgatc
gtcatcgtgacccacaacatgcagcaggcggcccgcgtgtccgaccagaccgcattcttc
tccctcgaggccaccggcaagcccggcaacctcgtggaggtgggccccaccaagaagatc
ttcgagaaccccgagaagtccgagaccgaggactacatctccggtcgcttcggataa

DBGET integrated database retrieval system