KEGG   Corynebacterium falsenii: CFAL_10515
Entry
CFAL_10515        CDS       T03037                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
cfn  Corynebacterium falsenii
Pathway
cfn00521  Streptomycin biosynthesis
cfn00523  Polyketide sugar unit biosynthesis
cfn00525  Acarbose and validamycin biosynthesis
cfn01100  Metabolic pathways
cfn01110  Biosynthesis of secondary metabolites
Module
cfn_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:cfn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CFAL_10515
   01055 Biosynthesis of vancomycin group antibiotics
    CFAL_10515
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CFAL_10515
   00525 Acarbose and validamycin biosynthesis
    CFAL_10515
Enzymes [BR:cfn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     CFAL_10515
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind NAD_binding_4 3Beta_HSD Polysacc_synt_2 adh_short KR Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: AHI03956
LinkDB
Position
complement(2387157..2388266)
AA seq 369 aa
MTGTARSASAPRTFTRLLVTGGAGFIGSNFVHRTLATRPDMQVVVLDALTYAANTDNLLA
DDGRPLGEAYPGRFRFIKADISDATAVAAALDSVVGSEGGSEADAAAETAIVHFAAESHN
DNSLHDPGIFARTNVEGTVNLAEAACAHGVHLHHVSTDEVFGDLALDEPRRFTVDTPYNP
SSPYSASKAAADHFIRAFVRSRGLKATISNCSNNYGPRQHPEKFIPRQVTGLLEGHQPRL
YGTGENVRDWIHVDDHNDAVWAILERGEVGNTYLIGAEGERSNKQVVEDLLEIFDRPSDD
YVHVTDRPGHDRRYAIDPASTRALGWKPQYTQFRQGLQATVDWYADHRQWWRAARVASEE
KYRRTEREI
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaccggcacagctcgcagcgcatccgcgccacgcactttcacccgccttctcgtcacc
ggaggggcgggttttatcggttccaacttcgtgcaccgcaccttagccacccgtccggac
atgcaggtcgtggtactcgatgctctgacctacgccgccaataccgataacctcttggcc
gatgatggtcggcctctcggggaggcctatcccggccgattccgcttcatcaaggctgat
atttccgacgccaccgccgtcgccgctgcccttgattccgtcgtcgggtcggaaggcggc
agcgaagctgacgctgccgcagagaccgccatcgtgcatttcgcggcggagagccacaac
gataattccctgcacgatccgggcatcttcgcccgaaccaatgtggagggcacggtgaat
ctcgccgaggccgcctgcgcgcacggcgttcacctgcaccacgtctccacggacgaagtc
tttggcgatttggcgctggacgagccgcggcgtttcaccgtggacaccccctacaacccg
tcgtcgccctattcggcgtcaaaggcggcggccgaccacttcatccgggcattcgtgcgc
tcgcgtgggctcaaggccacgatctcgaactgctcgaacaattacggaccgcgccagcat
ccggaaaaatttatcccccgccaggtcaccgggctgttggaaggccatcagccccggctc
tacgggacgggggagaatgtgcgggattggatccacgtggacgatcacaacgatgccgtg
tgggccatactcgagcgcggagaggtgggcaacacctacctcatcggcgcggaaggggaa
cggtcgaacaagcaggtcgtggaagacctgttggagatcttcgaccgcccatcagatgac
tacgtgcacgtcacagaccggcctgggcacgatcgccgctatgcgatcgatccggccagc
acccgcgcgctgggatggaaaccgcagtacacgcaattccgccagggcctgcaggccact
gtggactggtatgccgatcaccggcagtggtggcgggcggcgagggtggcgtcggaagaa
aaataccgacgaaccgagcgggagatctag

DBGET integrated database retrieval system