KEGG   Corynebacterium falsenii: CFAL_10610Help
Entry
CFAL_10610        CDS       T03037                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
cfn  Corynebacterium falsenii
Pathway
cfn00330  Arginine and proline metabolism
cfn01100  Metabolic pathways
cfn01110  Biosynthesis of secondary metabolites
cfn01130  Biosynthesis of antibiotics
cfn01230  Biosynthesis of amino acids
Module
cfn_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cfn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CFAL_10610
Enzymes [BR:cfn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     CFAL_10610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Sacchrp_dh_NADP GFO_IDH_MocA Shikimate_DH PDH TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AHI03973
UniProt: W5WSW1
LinkDB All DBs
Position
complement(2408394..2409224)
Genome map
AA seq 276 aa AA seqDB search
MTNIGIIGGGNIGEALLSGIIADGADPKTITVADPTQARLDELKDKYGLLTTTEGREAAE
SADLLFLCVKPDVVPVVIKDVAEALEAGSADTIIVSVAAGVTIGSMEKELPAGTPVVRVM
PNTPMLVGRGAAGIAGGQHAEQSHLDQVQEIMAKVGTAVVVKEKDLDAVTAVSGSGPAYV
FLVVESMIESAVQLGLPRPLAEKLAIANVDGAATMMRQGLEEGGDTPSVLRTKVTSPGGT
TAAALRELEESGIRGAFFRAMEACKDRSEELGKPKA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatattggaattattggtggaggaaacatcggcgaggctttgctctccggaatc
atcgcggacggagccgacccgaagaccattaccgttgcagacccgacgcaggcgcgtctc
gacgaattgaaggacaagtacggccttctcaccacgaccgagggtcgtgaggctgctgag
tctgcggatctgctgttcctgtgcgtcaagccggacgtagtcccggtcgttatcaaggac
gtcgccgaggccctagaggctggttctgcagacaccatcatcgtgtccgtcgccgccggc
gtgaccatcggttccatggagaaggagctgcccgccggtacgccggtggtgcgcgtgatg
ccgaacacgcccatgctcgtcggtcgcggcgctgccggtatcgccggtggtcagcacgct
gagcaatcccacctggatcaggttcaggagatcatggcgaaggttggcactgctgtcgtc
gtcaaggagaaggatctcgacgccgttacggcggtgtctggttccggacccgcgtacgta
ttcctcgtggtggaatccatgatcgagtcggccgtgcagttgggtctgccccggccgctg
gcagagaagctggccatcgccaacgtcgacggtgccgccacgatgatgcgccagggcctc
gaggagggtggcgacaccccatccgtgctgcgcacgaaggtcaccagcccgggtggtacg
accgccgctgcgctgcgagagctcgaagagagcggcatccgcggtgcgttcttccgcgct
atggaggcctgcaaggatcgctccgaggaactgggcaagccgaaggcgtaa

DBGET integrated database retrieval system